PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 69510
Common NameHANb-1, HANb-2, SELMODRAFT_107936, SELMODRAFT_451362
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GATA
Protein Properties Length: 59aa    MW: 6125.87 Da    PI: 10.0217
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
69510genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.79.1e-201650135
   GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
           C++Cg+tkTplWR+gp g+k+LCnaCG++y+k g+
  69510 16 CTQCGATKTPLWRNGPCGPKSLCNACGIRYKKVGS 50
           ********************************875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.75E-151053No hitNo description
PROSITE profilePS5011414.4171059IPR000679Zinc finger, GATA-type
SMARTSM004013.5E-131059IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.5E-161450IPR013088Zinc finger, NHR/GATA-type
CDDcd002021.11E-111556No hitNo description
PfamPF003201.5E-171649IPR000679Zinc finger, GATA-type
PROSITE patternPS0034401641IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
SSSEMSPGAT SPSRSCTQCG ATKTPLWRNG PCGPKSLCNA CGIRYKKVGS TKRTSNSSD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002966704.19e-35hypothetical protein SELMODRAFT_451362
RefseqXP_002978035.19e-35hypothetical protein SELMODRAFT_107936
SwissprotQ6QPM26e-14GAT19_ARATH; GATA transcription factor 19
SwissprotQ8LG104e-14GAT15_ARATH; GATA transcription factor 15
SwissprotQ9ZPX06e-14GAT20_ARATH; GATA transcription factor 20
TrEMBLD8R4U49e-35D8R4U4_SELML; Putative uncharacterized protein HANb-1
STRINGEFJ327313e-34(Selaginella moellendorffii)
STRINGEFJ206923e-34(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06740.13e-15GATA transcription factor 15
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]