PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 66294
Common NameSELMODRAFT_66294
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Trihelix
Protein Properties Length: 216aa    MW: 25118.5 Da    PI: 10.3671
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
66294genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix97.31.4e-30387187
  trihelix  1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87
              rW++qe+laLi++r+em+ ++r++ lk+plWeevs+++ e gf+rs+k+Ckek+en++k+ykk+k g+ +r+  + + +++f qlea
     66294  3 RWPRQETLALIRIRTEMDANFRDSGLKAPLWEEVSRRLGELGFQRSAKKCKEKFENVHKYYKKTKGGKAGRQ--DGKCYRFFAQLEA 87
              8********************************************************************985..5556******985 PP

2trihelix107.21.1e-33124208186
  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
               rW+kqev+aLi++r+ me+++++  +k+plWee+s  m + g++rs+k+Ckekwen+nk+++k+k+++k+r se+s+tcpyf+ql+
     66294 124 RWPKQEVHALIRLRSGMESKFQEPGAKGPLWEEISTSMGHMGYSRSSKRCKEKWENINKYFRKTKDSSKRR-SENSKTCPYFQQLD 208
               8********************************************************************98.88899*******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.201160IPR017877Myb-like domain
SMARTSM007171.1162IPR001005SANT/Myb domain
CDDcd122032.45E-23259No hitNo description
PfamPF138379.4E-21288No hitNo description
PROSITE profilePS500907.294117181IPR017877Myb-like domain
SMARTSM007170.0029121183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-5122180IPR009057Homeodomain-like
PfamPF138371.5E-21123209No hitNo description
CDDcd122035.73E-29123188No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 216 aa     Download sequence    Send to blast
GNRWPRQETL ALIRIRTEMD ANFRDSGLKA PLWEEVSRRL GELGFQRSAK KCKEKFENVH  60
KYYKKTKGGK AGRQDGKCYR FFAQLEALYG SNSSGAGAIT PVGKQQSDLQ DEDFKEHFDP  120
NSKRWPKQEV HALIRLRSGM ESKFQEPGAK GPLWEEISTS MGHMGYSRSS KRCKEKWENI  180
NKYFRKTKDS SKRRSENSKT CPYFQQLDML YRTGVL
Functional Description ? help Back to Top
Source Description
UniProtTranscription repressor that binds specific DNA sequence such as GT3 box 5'-GGTAAA-3' in the SDD1 promoter. Negative regulator of water use efficiency (WUE) via the promotion of stomatal density and distribution by the transcription repression of SDD1. Regulates the expression of several cell cycle genes and endoreduplication, especially in trichomes where it prevents ploidy-dependent plant cell growth. {ECO:0000269|PubMed:19717615, ECO:0000269|PubMed:21169508}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Down-regulated by water stress. {ECO:0000269|PubMed:21169508}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024522974.13e-80trihelix transcription factor GTL1, partial
RefseqXP_024532616.16e-80trihelix transcription factor GT-2 isoform X2
SwissprotQ9C8829e-41GTL1_ARATH; Trihelix transcription factor GTL1
TrEMBLD8RM021e-160D8RM02_SELML; Uncharacterized protein (Fragment)
STRINGEFJ270201e-161(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76880.11e-40Trihelix family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Caro E,Desvoyes B,Gutierrez C
    GTL1 keeps cell growth and nuclear ploidy under control.
    EMBO J., 2012. 31(24): p. 4483-5
    [PMID:23188085]
  3. Zheng X, et al.
    The Wheat GT Factor TaGT2L1D Negatively Regulates Drought Tolerance and Plant Development.
    Sci Rep, 2016. 6: p. 27042
    [PMID:27245096]
  4. Shibata M, et al.
    GTL1 and DF1 regulate root hair growth through transcriptional repression of ROOT HAIR DEFECTIVE 6-LIKE 4 in Arabidopsis.
    Development, 2018.
    [PMID:29439132]