PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 5960
Common NameMADS7-1, MADS7-2, SELMODRAFT_450800, SELMODRAFT_450939
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family M-type_MADS
Protein Properties Length: 144aa    MW: 16178.4 Da    PI: 10.0242
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
5960genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.41.8e-181150342
            --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
  SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
            i+n+  rqvtf kR++g+ KKAeEL +LC+++v++i +++
    5960 11 IKNDASRQVTFNKRKKGMKKKAEELAILCGVDVCMICYGP 50
            99************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006619.455146IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.02E-20155IPR002100Transcription factor, MADS-box
SMARTSM004322.4E-20160IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-12323IPR002100Transcription factor, MADS-box
PfamPF003198.6E-201151IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-122338IPR002100Transcription factor, MADS-box
PRINTSPR004041.9E-123859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MGRSKIPITW IKNDASRQVT FNKRKKGMKK KAEELAILCG VDVCMICYGP ASSSAGSSSK  60
QPNSTPGSIG SSNQQPQSSA GSKFEGLPKE ERDKKKLDNT SLLEQQIKKL RRELKAKLDQ  120
NWKLEQERAY NLAWDDRIDG YDLE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLD8RIH95e-72D8RIH9_SELML; Type I MADS-domain transcription factor
STRINGEFJ077698e-73(Selaginella moellendorffii)
STRINGEFJ280958e-73(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4541427
Representative plantOGRP11413173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.16e-12AGAMOUS-like 80
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]