PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 57477
Common NameSELMODRAFT_57477
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 133aa    MW: 15436 Da    PI: 10.1946
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
57477genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.22.1e-34155155
  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
             k+rlrWt+eLH+rFveav+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
    57477  1 KQRLRWTSELHDRFVEAVTQLGGPDRATPKGVLRIMGVHGLTIYHVKSHLQKYRL 55
             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015575.1E-27156IPR006447Myb domain, plants
PROSITE profilePS5129416.589158IPR017930Myb domain
SuperFamilySSF466894.48E-18155IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-32156IPR009057Homeodomain-like
PfamPF002492.2E-9354IPR001005SANT/Myb domain
PfamPF143792.6E-2382129IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
KQRLRWTSEL HDRFVEAVTQ LGGPDRATPK GVLRIMGVHG LTIYHVKSHL QKYRLAKFIP  60
DSSGDGTLFD SYLSSKCLCR GIQLTEALRM QMEVQKRLHE QLEVQRQLQL RIEAQSTYLA  120
KIIEEQQKMR GML
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-26158158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-26158158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-26158158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-26158158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024534757.12e-78myb family transcription factor PHL6
RefseqXP_024534758.12e-78myb family transcription factor PHL6
RefseqXP_024544435.12e-78myb family transcription factor PHL6
RefseqXP_024544436.12e-78myb family transcription factor PHL6
SwissprotQ9SJW04e-66PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLD8RS239e-93D8RS23_SELML; Uncharacterized protein (Fragment)
STRINGEFJ249902e-93(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.18e-53G2-like family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]