PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 56382
Common NameSELMODRAFT_453332, Sm_HAIRY_MERISTEM1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRAS
Protein Properties Length: 336aa    MW: 36474.6 Da    PI: 6.2449
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
56382genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS288.51.8e-88133634373
   GRAS  34 dgdpmqRlaayfteALaarlarsvselykal..ppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasR 135
            +g+ +qRla+yf+eALaar+ ++ + +  +   ++ +t++ +   ++ a++ f e+sP+l+f++l aNqaIlea++ge  vHi+Dfd + G QW+aLl+  a  
  56382   1 QGKRIQRLAFYFKEALAARMIDHHPATTTTTttTSATTTPAEIFAKVRAYTSFCEISPLLRFAYLSANQAILEAIQGEASVHIVDFDPGFGSQWAALLEDVART 104
            57899*****************777766655213333444447788888999**************************************************99 PP

   GRAS 136 p..egppslRiTgvgspesgskeeleetgerLakfAeelgvpf..efnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvksls 235
            p   ++p+lR+T vg+    +  +l  + e L++fA el+++   +f ++ + +  ++++  L +  gE ++Vn++++lhr l+ ++     +d+ +++v + s
  56382 105 PaaLPQPRLRLTLVGP----DPARLGFVVESLREFAGELHLRHtpQFGLVQCAAAGEMTPPLLGLTDGEPVVVNFMFSLHRSLAARGG----TDAAVSAVMTAS 200
            9666799*********....9******************99864489999999*****************************944444....666********* PP

   GRAS 236 PkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqakl 339
            P++v+++e+e+d n+++F +rf+e+l+yy+ ++dsl  +   +     +vE+ +l++ i n+v+ ega+r+erhe+l++Wr+rl++ G++pvp++e a +qa++
  56382 201 PRLVTIAEEEVDDNDGKFQRRFVETLQYYAFVLDSLGPE---DGAGVLTVEKDILSPGIANAVSLEGARRTERHERLAQWRARLGRGGLEPVPMGEAARMQAEC 301
            ************************************877...678899******************************************************** PP

   GRAS 340 llrkvk.sdgyrveeesgslvlgWkdrpLvsvSaW 373
            l++ ++ ++ ++v  ++g l+lgW+++pLv+vS+W
  56382 302 LIKGHShGKNFEVCRDEGGLLLGWQGKPLVAVSSW 336
            ******9999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.5381316IPR005202Transcription factor GRAS
PfamPF035146.3E-861336IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
QGKRIQRLAF YFKEALAARM IDHHPATTTT TTTTSATTTP AEIFAKVRAY TSFCEISPLL  60
RFAYLSANQA ILEAIQGEAS VHIVDFDPGF GSQWAALLED VARTPAALPQ PRLRLTLVGP  120
DPARLGFVVE SLREFAGELH LRHTPQFGLV QCAAAGEMTP PLLGLTDGEP VVVNFMFSLH  180
RSLAARGGTD AAVSAVMTAS PRLVTIAEEE VDDNDGKFQR RFVETLQYYA FVLDSLGPED  240
GAGVLTVEKD ILSPGIANAV SLEGARRTER HERLAQWRAR LGRGGLEPVP MGEAARMQAE  300
CLIKGHSHGK NFEVCRDEGG LLLGWQGKPL VAVSSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-39233637374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002976818.10.0GRAS family protein
TrEMBLD8S0H10.0D8S0H1_SELML; GRAS family protein
STRINGEFJ219280.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66350.14e-53RGA-like 1
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]