PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 47303
Common NameSELMODRAFT_47302, SELMODRAFT_47303
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 72aa    MW: 8197.52 Da    PI: 11.6211
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
47303genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.37e-33760255
  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              r+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
    47303  7 RRMRWTSTLHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 60
             69***************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.03E-17461IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-29560IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-25761IPR006447Myb domain, plants
PfamPF002492.1E-8859IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 72 aa     Download sequence    Send to blast
KRSMRARRMR WTSTLHAHFV HAVELLGGHE RATPKSVLEL MNVKDLTLAH VKSHLQMYRT  60
IKTTDKASSS SG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-19862458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002983716.23e-43uncharacterized protein LOC9644200
RefseqXP_002989046.23e-43uncharacterized protein LOC9629510
SwissprotQ9C6161e-39KAN2_ARATH; Probable transcription factor KAN2
TrEMBLD8SKE41e-44D8SKE4_SELML; Uncharacterized protein (Fragment)
STRINGEFJ098402e-45(Selaginella moellendorffii)
STRINGEFJ152122e-45(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5701580
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.26e-43G2-like family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]