PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 444089
Common NameSELMODRAFT_444089
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family CO-like
Protein Properties Length: 453aa    MW: 49233.8 Da    PI: 7.934
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
444089genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.74.8e-08244339
  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
              er C+ +++++++ +C+ +  llC +C  + H        H++
    444089  2 ERPCDFCGDERATVYCKADAALLCLSCDRNVHDAnalsrrHSR 44
              689***************************9943566666765 PP

2CCT61.33.1e-21395438144
     CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
             R +a+lRYkeKrktRk+eK+irYesRK++A++R R+KGrFvk+ 
  444089 395 RGNAMLRYKEKRKTRKYEKRIRYESRKTRADTRRRIKGRFVKAG 438
             7789*************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.352147IPR000315B-box-type zinc finger
SMARTSM003361.3E-10147IPR000315B-box-type zinc finger
PfamPF006437.7E-6243IPR000315B-box-type zinc finger
CDDcd000213.85E-8347No hitNo description
PROSITE profilePS5101715.09395437IPR010402CCT domain
PfamPF062031.2E-15395437IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005886Cellular Componentplasma membrane
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MERPCDFCGD ERATVYCKAD AALLCLSCDR NVHDANALSR RHSRTLVCDM CVVQPAVVRC  60
GAESKAFCQA CDGKRHAEYR AMHHKRRAIV SYTGCPSSAE LARLWYCDVS DEPGGNGSGN  120
GSGKGSTSKC LETFQGWVPA SSQSQQQLHH PSTPQSREKK IFQQLMILQN RPPQQGLGHQ  180
QREKAITQAQ TLMPPPPPRP STSSSNGVAE IQYQTAQLGL HSPSSKPESG EIFPQQGENA  240
WKAASPDQQL WNNAQDMGID DICKALTADD VNVFDNYEDL FLSAQDAAGT PFQDIGIACP  300
SMAPAMSSKS MQNGCSSMDT ANSLQSDASE SACRGPFHPA AAAGNVQFSP RPACSSGVSG  360
DSSGTEYADC ASVFYSAGEL WSSTSSDPAA ASEARGNAML RYKEKRKTRK YEKRIRYESR  420
KTRADTRRRI KGRFVKAGQV YDYDPLSTTR SY*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002978965.10.0zinc finger protein CONSTANS-LIKE 14
TrEMBLD8S6D10.0D8S6D1_SELML; Uncharacterized protein
STRINGEFJ199220.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP13751334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48250.13e-37B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]