PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 443191
Common NameSELMODRAFT_443191
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family CPP
Protein Properties Length: 711aa    MW: 75524.2 Da    PI: 7.8695
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
443191genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.15.6e-16389427341
     TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
             +k+C+CkkskClk+YCeCfaag++C ++C C dC+Nk e
  443191 389 CKRCHCKKSKCLKLYCECFAAGVYCLDSCACRDCFNKPE 427
             79**********************************975 PP

2TCR50.25.2e-16491528138
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkN 38 
             ++k+gCnCkks ClkkYCeC++ag+ Cs+ CkC++CkN
  443191 491 RHKRGCNCKKSLCLKKYCECYQAGVGCSDGCKCNGCKN 528
             589**********************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-16387428IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.699388531IPR005172CRC domain
PfamPF036381.4E-11390425IPR005172CRC domain
SMARTSM011143.6E-16491532IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.5E-12493528IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 711 aa     Download sequence    Send to blast
MTSSLLAHPA ASSAVQGSPL FKFLCSLSPI KQAKSAHVAQ TYSELSFPAP LPVFVSPKKK  60
RERAGVARTS GATSRESETT EASDLTCSPP AEEVLNQQQK NTSDTSADAT EEIPSKQDAT  120
LASFLPGQDH TPEGAASFKN SGDEPDSEAA NLEVANMEKL AITGHTDHTD STVEDVRTSR  180
NQRGARRRCL DFQSDSQESN AENLSCIVSP GVSSTPTSGP ESLSTLISSL SGSGCSDSCK  240
KLMREAVPSG IGLHLNSLGL LTAPRGVSLQ SLVSCSQEMQ SAEGFALCGQ GPMNLRPGLL  300
FSVVEKTRME QEVQGTSGSQ EGLLTSTTCV RSLTLGIQAM DEGTPFGIEQ VVTPGRKRLS  360
MQSDSMDGEM GRTPKKRRKS LGEKAGDGCK RCHCKKSKCL KLYCECFAAG VYCLDSCACR  420
DCFNKPEFAD TVMGTRQQIE TRNPLAFAPK IVQTSDNTPT EGVGIWFSGH AMTNSLFALQ  480
PNCPDTTGSA RHKRGCNCKK SLCLKKYCEC YQAGVGCSDG CKCNGCKNIY GIKKGTSFLL  540
VSCFDFDDPH PLQINSNSSL TSLSPITPTL IQHASVCTSI VPCDSTNTPS STTPATSVSK  600
LMDSNSLAWD ETPEFLRAPR SSPRSMLNDL LSSDEAPEFI RAERSSPRSG IKGSPKQKRV  660
APPNAGLLAA GGAPSSSSVL KSGRKLTLQS LPSLPPVTPF SFPHQGCKRS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1355377RKRLSMQSDSMDGEMGRTPKKRR
2373379PKKRRKS
3374378KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00433DAPTransfer from AT4G14770Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002976465.10.0hypothetical protein SELMODRAFT_443191
TrEMBLD8RZD60.0D8RZD6_SELML; Putative uncharacterized protein
STRINGEFJ227250.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9931755
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.15e-67Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]