PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 442384
Common NameSELMODRAFT_442384
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRF
Protein Properties Length: 818aa    MW: 86038.5 Da    PI: 8.5009
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
442384genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.33e-24304348145
     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
             d+epgrCrRtDGKkWRCsr+v++++k+C+rH+hrgr+rs+k  e+
  442384 304 DPEPGRCRRTDGKKWRCSREVVPDQKYCDRHMHRGRNRSKKNAEN 348
             79***************************************9876 PP

2QLQ58.71.8e-20238274137
     QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
             ++FTa+Q+++L++Q+l++Ky++a++ vPpeLl +i++
  442384 238 GPFTANQWAELEHQALIFKYMMAGASVPPELLNPIRR 274
             59*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.2E-12238274IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.139239274IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.9E-15239273IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.816304348IPR014977WRC domain
PfamPF088793.7E-21305345IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 818 aa     Download sequence    Send to blast
MDLLHQNSSS PGLGICSSLG VLSPDNRMPS SYNSSGTSSG PLSPNLSSMK QCRSSSDVEV  60
DARDDGGPLK LARKDSFSYS RPSAAEQHQQ HQHSQQQQQQ HVGKLNMNSG GGGGAPAAAA  120
AANNNNGPAG SHSFSGDNGG SRIACSPTNS CLSDGVLVAS DAAAAANLMG GDTRMLRSDA  180
MASPGSSYNL AAANSNMRPF SYQSYQYPGA SGSPLMLAAA AAARGDHLGM QSAMSMRGPF  240
TANQWAELEH QALIFKYMMA GASVPPELLN PIRRSVALNN LASSHPSLRM GWGNFHLGIP  300
NNPDPEPGRC RRTDGKKWRC SREVVPDQKY CDRHMHRGRN RSKKNAENQA AAAAAAAAAN  360
SQSAAAAAAG GNTTTQSATN VGGVVQSSGL NQIHSSLRPP LGMNGQNHHQ HPSVGAAAAA  420
AASPFNSGTP TKSNFSSLPT GIPSGNNSGS SLQFPMQSLS GASPGGNKDY RYMSGMSKPE  480
LGLGPEQLLF SDSPLSSVHH QWQQNFQSKF PRLSSSSSNN SPSSPLYPQH QHHHHHHHHQ  540
QELRSLSGQQ HFEMPEASQI NHLSQPLLGP GYGGGPTAAA AAAGLEHVGR DCEEQPLRHF  600
FDDWPRQRDP STISWNDIED DQKQHQHQNQ QRAATPPTAV TAPGAGGTTT IPRTTSATQL  660
SISLPMSSSD FRVATSPRGK LSLSPLKLSM SRSEFEEDQL GGDPTRMGLG VGLGGGSRQQ  720
QQQQQQTWMQ SLEGGPLAEV LQSSTPRDHC KSSPGLNLLG DGWESSSRET SRMPSPTAVL  780
TKTPFGSFSD SSSNASSPRA VHAEALLGNA GSKQLTS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002974366.10.0hypothetical protein SELMODRAFT_442384
TrEMBLD8RSZ90.0D8RSZ9_SELML; Putative uncharacterized protein
STRINGEFJ245880.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.19e-43growth-regulating factor 5
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]