PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 442062
Common NameSELMODRAFT_416566, SELMODRAFT_442062
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 309aa    MW: 33177.5 Da    PI: 5.4257
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
442062genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like92.24.3e-2971121151
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
              k+rlrWtpeLH+rF+eav+qLGGs+kAtPk +l lm+v+gLt++h+kSHLQ
   442062  71 KQRLRWTPELHDRFMEAVNQLGGSDKATPKGVLGLMGVQGLTIYHIKSHLQ 121
              79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.32268128IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.3E-2769121IPR009057Homeodomain-like
SuperFamilySSF466894.84E-1570123IPR009057Homeodomain-like
TIGRFAMsTIGR015577.7E-2271121IPR006447Myb domain, plants
PfamPF002497.2E-873121IPR001005SANT/Myb domain
PfamPF143791.0E-24161207IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MMLQPKNSPS SVVAAAPVAP QVPSSPAAAG DLVCFSTPPP AAAVPSTPAA ALANNVASTP  60
AASSGNVASV KQRLRWTPEL HDRFMEAVNQ LGGSDKATPK GVLGLMGVQG LTIYHIKSHL  120
QARILNLLLP KFRLAKYLPD TLGDGELEKG RDLEADSRGR QLSEALRMQM EVQKRLHEQL  180
EVQRHLQLRI EAQGKYLQRI LEEQQKMNKL LRGDDGLPLS PIKLDADPDP EPDPAIDLTD  240
DSAEDEEHKP TTADVILVDE EKLAGGSLAA AAVDSGEEPH AKRKKVDDLQ HSQHKDNGAE  300
GDAKENGR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-2271137158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-2271137158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-2271137158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-2271137158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024533998.10.0myb family transcription factor PHL7 isoform X2
RefseqXP_024537464.10.0myb family transcription factor PHL7 isoform X2
SwissprotQ9SJW01e-58PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLD8RPX40.0D8RPX4_SELML; Uncharacterized protein
STRINGEFJ223400.0(Selaginella moellendorffii)
STRINGEFJ255550.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-57G2-like family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]