PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 438638
Common NameSELMODRAFT_438638
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 295aa    MW: 32547.5 Da    PI: 6.5213
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
438638genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-3352106155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              kprlrWtpeLH++Fv+av+qLGG+ekAtPk++l+lm+v+gLtl+h+kSHLQkYRl
   438638  52 KPRLRWTPELHDQFVKAVAQLGGPEKATPKSVLKLMGVQGLTLYHLKSHLQKYRL 106
              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-3249107IPR009057Homeodomain-like
PROSITE profilePS5129412.56149109IPR017930Myb domain
SuperFamilySSF466892.87E-1751108IPR009057Homeodomain-like
TIGRFAMsTIGR015574.8E-2452106IPR006447Myb domain, plants
PfamPF002491.5E-1054105IPR001005SANT/Myb domain
PfamPF143791.3E-7137177IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MGVTELQASV KALVRSGGEF NQDKACSTFY YVPSSGEASA HLSASGLGND QKPRLRWTPE  60
LHDQFVKAVA QLGGPEKATP KSVLKLMGVQ GLTLYHLKSH LQKYRLGMQI PRPETSGDGR  120
SNSEDSSKQQ ESLPLTQIIA VHAEVEKKLR EQMEIQQQLQ ARIDEQCQHL YKLMESASPQ  180
KKSIMADLEA ARKLQLDGIM ELSKMYSGLQ SAVEQHGKLD QATSNNTAGI KRRPNDDDPQ  240
RQLEEEQERV TKSLVQWKKE PVWDDDEAQH ASGSTAEIST GLNLSSGRGL DLNG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A6e-2152105154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-2152105154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-2152105154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-2152105154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-2152105255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002988201.20.0uncharacterized protein LOC9636347
TrEMBLD8QX780.0D8QX78_SELML; Uncharacterized protein
STRINGEFJ353620.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.15e-41G2-like family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]