PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 423505
Common NameSELMODRAFT_423505
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 308aa    MW: 33637.7 Da    PI: 6.0649
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
423505genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.1e-3194148155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              k+rlrWtpeLH+rFveav+ LGG+e AtPk++l +m v+ +t++hvkSHLQkYRl
   423505  94 KQRLRWTPELHQRFVEAVALLGGPETATPKSVLSVMAVPEITIYHVKSHLQKYRL 148
              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.55490151IPR017930Myb domain
SuperFamilySSF466891.47E-1694149IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-2994149IPR009057Homeodomain-like
TIGRFAMsTIGR015578.0E-2594149IPR006447Myb domain, plants
PfamPF002494.4E-896147IPR001005SANT/Myb domain
PfamPF143793.4E-12178209IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MDDAEFSAAL EMMLCSPQEQ GGGGNGLMKN EVEWAQEGWT SLLNPSDGGG DGEESSSKKG  60
VVVPQFVQVR DNSGSATPSN SSSSGGSGIS PNLKQRLRWT PELHQRFVEA VALLGGPETA  120
TPKSVLSVMA VPEITIYHVK SHLQKYRLNK QIPEDPEGAP KPEKKKLTLN KLAETTAVTE  180
NLRLQMEVQR RLHETIEIQR QLQLQIEARL QLMHDGELKL KHTQTKSIQS EDKGEPEATC  240
SSKRDEVVAE AAANPRLAVP KTKRPLDHEE DHTEETSEVT CNNATVSPKR RLKLSQPGAS  300
ESSVVSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-2094147154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-2094147154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-2094147154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-2094147154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-2094147255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as central integrator of phosphate starvation responses (PubMed:20838596). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). {ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:23788639}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not up-regulated by Pi starvation. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002984454.20.0uncharacterized protein LOC9644051
SwissprotQ8GUN52e-38PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLD8SLX50.0D8SLX5_SELML; Uncharacterized protein
STRINGEFJ145040.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.14e-34G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  4. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  5. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]