PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 420739
Common NameSELMODRAFT_420739
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRF
Protein Properties Length: 326aa    MW: 36455.8 Da    PI: 8.3218
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
420739genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC67.12.3e-21157200143
     WRC   1 daepgrCrRtDGKkWRCsrrvle.gkklCErHlhrgrsrsrksk 43 
             d+epgrCrRtDGKkWRC + v++ ++k+CErH+hrgr+rs+ksk
  420739 157 DSEPGRCRRTDGKKWRCAKPVVAvDQKYCERHIHRGRNRSKKSK 200
             689****************98754******************98 PP

2QLQ552.4e-19102137237
     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
             +FTa+Q+ +L++Q+l++Ky++a++PvP+eL+ +i++
  420739 102 PFTASQWLELEHQALIFKYMLARAPVPAELIIPIRR 137
             8*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.2E-12101137IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.5E-14102136IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.191102137IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.854157202IPR014977WRC domain
PfamPF088796.4E-20159200IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDLRLNQLYN NSKRSPPPPS SSSPLPLDSY EHHAEAAAAS AAAAAAARFY SSDRPPPTSH  60
RMLDQHTGST FIPMAADYGH FCDTALKQAG AAAGDFHHGH FPFTASQWLE LEHQALIFKY  120
MLARAPVPAE LIIPIRRAFS LSPNTFQVGL CPSNLMDSEP GRCRRTDGKK WRCAKPVVAV  180
DQKYCERHIH RGRNRSKKSK ATLTPTDAQP PQNPSPLPAP VHQHSKVPDF VERPTDKHNE  240
DQRGSCGPRP EQDTDHGHSR KTPEALLRHF FDDWPRASEG REQNPSPHFE EEEPPVVQNT  300
RTSSCFPQPN WHWNMPTKMS ILPTL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002981090.10.0hypothetical protein SELMODRAFT_420739
TrEMBLD8SCZ00.0D8SCZ0_SELML; Putative uncharacterized protein
STRINGEFJ177910.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP4601684
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.12e-31growth-regulating factor 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]