PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 420712
Common NameSELMODRAFT_420712
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family CPP
Protein Properties Length: 462aa    MW: 50711 Da    PI: 8.5059
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
420712genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR37.54.7e-1295135142
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
             k++k+CnCk+++Clk+YCeCfa+g++C+  C+C +C+N+ e+
  420712  95 KKCKQCNCKNTRCLKLYCECFASGTYCDG-CNCLNCCNNVEN 135
             589**************************.********9875 PP

2TCR52.11.3e-16176215140
     TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
             k++kgCnCkks ClkkYCeCf+a+  Cs++CkC dCkN +
  420712 176 KHNKGCNCKKSGCLKKYCECFQANILCSDNCKCVDCKNYD 215
             589***********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.8E-1295135IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.49796216IPR005172CRC domain
PfamPF036383.0E-898132IPR005172CRC domain
SMARTSM011146.5E-20176217IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.6E-13179214IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MQLNGIKADQ FDKDEKPVIP AHLDMNGSSL VTMQGPGKLP LYSSSRLSRT SQALPSSQVP  60
PAQPGEPGRK PVRQLNFSSI LPRPPVYELK EVAAKKCKQC NCKNTRCLKL YCECFASGTY  120
CDGCNCLNCC NNVENEAVRQ EAVEVTLERN PNAFRPKIAN TQHAIRDSAD DMRLGKHNKG  180
CNCKKSGCLK KYCECFQANI LCSDNCKCVD CKNYDSSDER RALYQPDYSQ STYHGGPPPY  240
TTSATGSLAC VSSSPMPAKK RRTSDLVFVG ESLKVQQPIY RTLQGIQDAK LSGSMLPPNS  300
SLSAKTIQTS LLAGVVQPET VSDLCNLLVM ASAEAAKAMI ASGPVSKRPA ENGQEAGSGQ  360
GDEDIREKRP MSPGTLALMC DEQDPLFTPA THGDYDKELA AEQERLILEE FRDCLRKIIT  420
VGRKRGTLLK FSQTLPLYYL QKPQGASFWQ RLFKRIASPR V*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00269DAPTransfer from AT2G20110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002981074.10.0hypothetical protein SELMODRAFT_420712
TrEMBLD8SCV70.0D8SCV7_SELML; Putative uncharacterized protein
STRINGEFJ177750.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14691745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-76Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]