PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 417629
Common NameSELMODRAFT_417629
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 278aa    MW: 31229.5 Da    PI: 8.8077
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
417629genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.97.4e-314191151
  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
             kprlrWtpeLHerFveav+qLGG+ekAtPk+++++m+vkgLtl+h+kSHLQ
   417629 41 KPRLRWTPELHERFVEAVTQLGGAEKATPKSVMRIMGVKGLTLYHLKSHLQ 91
             79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.3923898IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-293991IPR009057Homeodomain-like
SuperFamilySSF466891.45E-144094IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-214193IPR006447Myb domain, plants
PfamPF002497.9E-84391IPR001005SANT/Myb domain
PfamPF143792.5E-25146192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 278 aa     Download sequence    Send to blast
MYQVKNFSPG TNFMSQQQQQ QPTLYTGLSV EQAKISASEP KPRLRWTPEL HERFVEAVTQ  60
LGGAEKATPK SVMRIMGVKG LTLYHLKSHL QFLMLCFHQK FRLGKQLNKD TNVANRNASI  120
VSYNTPNAQD LIAQQGHLSS SSSDSQITEA LRLQMEVQKK LHEQLEVQRH LQLRIEAQGK  180
YLQALLEKAR ETFSVGGQDL NASVKLELCK AASSAETTLE QQLLFAREQR LQSHNLHQPQ  240
AHHIMGNKME QGLDLNCKEV NGLDLNEFGW AAGPTES*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-194191252Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024538553.11e-178protein PHR1-LIKE 2
SwissprotQ94A578e-56PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLD8S3250.0D8S325_SELML; Uncharacterized protein
STRINGEFJ211920.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.15e-58G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]