PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 414222
Common NameSELMODRAFT_414222
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 367aa    MW: 40539 Da    PI: 8.1136
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
414222genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-321770255
  G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
             prlrWtp+LH++Fv+ave+LGG+e+AtPk +l+lm+vkgLt++hvkSHLQ+YR+
   414222 17 PRLRWTPDLHHSFVSAVERLGGQERATPKLVLQLMDVKGLTIAHVKSHLQMYRS 70
             8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.0E-311372IPR009057Homeodomain-like
PROSITE profilePS5129411.4121373IPR017930Myb domain
SuperFamilySSF466898.96E-151672IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-221771IPR006447Myb domain, plants
PfamPF002493.6E-81869IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MARTGGAVRQ YVRSKLPRLR WTPDLHHSFV SAVERLGGQE RATPKLVLQL MDVKGLTIAH  60
VKSHLQMYRS MKSDENFNVN TQTDGESISD SQSPRAARFP GEFVLPDHDQ SERSSLYNNS  120
HLHPEPTVQG ALLATTNRYS PSIRCDTSSG PCIAWPGDVS DHGSGLCCFR EWQGREFHVT  180
DDALQAPELA DGFRRRKRSC TRECPKDTVS QASEVRNGGH AAAGYENFHF LDINRSSSSR  240
SDDKRETRQL LLSGTLSEPT REIHGAERSN VLDFRISLPG LLEDDGKLVD STLSLSLPNS  300
SSTATSSFSR HQQFPERPSP SPTASTCHWN QASAQRSSMA KPTFKLEHTS NRRPPNLDLT  360
MAIGAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-191872357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-191872357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-191872357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-191872357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002973839.10.0uncharacterized protein LOC9643034 isoform X1
TrEMBLD8RS220.0D8RS22_SELML; Uncharacterized protein
STRINGEFJ247940.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28515123
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.18e-32G2-like family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]