PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 412762
Common NameSELMODRAFT_412762
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRF
Protein Properties Length: 755aa    MW: 77767 Da    PI: 9.8509
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
412762genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC67.71.6e-21278319142
     WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
             daepgrCrRtDGKkWRC r  ++++k+CErH++rgr+++++s
  412762 278 DAEPGRCRRTDGKKWRCARPIVPDQKYCERHINRGRHKKKSS 319
             79************************************9987 PP

2QLQ509.2e-18208242236
     QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
             +FT  Q+++L++Q+l++Ky++a++PvPpeL+++i+
  412762 208 PFTSLQWAELEHQALVFKYILARAPVPPELIAPIR 242
             9*********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-10207243IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.585208243IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.8E-13208242IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.563278322IPR014977WRC domain
PfamPF088798.3E-19279319IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 755 aa     Download sequence    Send to blast
MDLMGSSTNT TTSSSEKSSS SSKCRRLGDI LPATPTTSNK TARTSSDSAK QSSRSGGSSP  60
GHHGQQQHQH QHQRQRSCGS PTDSSTAATA ATEDHLLHTS GSISSPPNSF ANSSSSSQHS  120
GMILMPPPTM AGAGPSAVSA SSYGTMGGAM AMPGMGGGGG AMNLARSPML FQQQPAMKQS  180
MGFQQQLAMG SASSLLGLHE AFMASRYPFT SLQWAELEHQ ALVFKYILAR APVPPELIAP  240
IRSTSFSSIL GGGGSWPCTI PSSANAGSGH GVHTNHLDAE PGRCRRTDGK KWRCARPIVP  300
DQKYCERHIN RGRHKKKSSA ATAAAVAAAA AATTGGGGMG RVSSTTSTST STSSTSGIIA  360
SSHGGEHHPG ELSTAFEISN ASSSMFHHHR SSSLADARTR KLARWRFLPA RGVGSHFVCV  420
RIWSLRFLNG ISKATSFDLR PEQLLLSEVP GGSAAALAAP GSGISANQSN FPGAAARGGV  480
NPTSAAAPPP FFQLPKSNAS STSNSASSNP DSPYFSYSKL FHNASDESQH CLSSLLASPP  540
QHQHNQQLNY YASDPSVAEK IKPDTSHALR PLFNEWPRSR DASTMTSWSD SDDRKPCQQQ  600
LHKLKLGGGG THLSISIPST ASGGSHEDGG GNDSMVKLCM GSSVEELTDS ATNGGGGGGG  660
GSSGGGLIKP GGGVVELGWF SAARASVGGP LAEAFNASEV KSSGLTFLGG SARDLRQLQV  720
VSPTGVLQRS GLGSFSESSS SASSPGSIKV EQLH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002971987.10.0hypothetical protein SELMODRAFT_412762
TrEMBLD8RLE20.0D8RLE2_SELML; Putative uncharacterized protein
STRINGEFJ269040.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP33571226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.19e-33growth-regulating factor 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]