PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 410828
Common NameSELMODRAFT_410828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 550aa    MW: 61096.7 Da    PI: 8.1557
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
410828genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.43.8e-093476347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT eE+e++  a +q G++ +++I + +   +   q++++++ +
           410828 34 AWTHEEEEKFFSALRQVGKD-FEKITSQVV-SKNKDQVRHYYYRL 76
                     6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-112781IPR009057Homeodomain-like
PROSITE profilePS5129314.3813081IPR017884SANT domain
SMARTSM007173.7E-73179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-63479IPR009057Homeodomain-like
PfamPF002493.5E-73476IPR001005SANT/Myb domain
CDDcd001671.40E-63477No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MLETTDSSPA LSQDTTPEQQ EPVESGKRTR QWAAWTHEEE EKFFSALRQV GKDFEKITSQ  60
VVSKNKDQVR HYYYRLIKRM NKFLRSDLLI DARNSKDVDS AMLCWWSLLE KFKCSSSKLH  120
LKPRRLKAIA TALEQHRLKD RKKAKKKVKA PSTSTDKPAS VVAGEVRKRS FTRAPVRPQV  180
KAASDSVLEP PESELNSKII EGGKPEENNM EKQNSVSTPT PSEPNLKSST SVPQMETAVL  240
KIKLQLFPID DKTKTALEQE GHNPHLELTL KASKSISSVL QHLSQKWGRC SVATGDIRLY  300
PFIRQPSSTS WNSKDVVCAA DVYDAVGRPS VFRLRYGWCQ NVCEKSSKSG AEPVTVIERH  360
EDHSQLDSQV PGCSWLYDRS TDGFGQRLWR DEELLGASSV DRFIVLNDAS KQDADRYSLT  420
PSVWGGEETC DAFSFKTKEH IRVVPPARES AACSLLGTSQ GTSSFDLFRS SSNADVLRSS  480
ALDLYWADSL GAVDGTFAHG QSLLLNGNSS LGGGISTSLF PDSPDAFAQQ TPGVLLSPND  540
IHMVEVDRQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002970087.10.0hypothetical protein SELMODRAFT_410828
TrEMBLD8RG000.0D8RG00_SELML; Putative uncharacterized protein
STRINGEFJ292110.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP21641015
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.32e-48TSL-kinase interacting protein 1
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]