PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 405399
Common NameSELMODRAFT_405399
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 344aa    MW: 36773.1 Da    PI: 9.5694
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
405399genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-3369123155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              k+rlrWtp+LHerFveav qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
   405399  69 KQRLRWTPDLHERFVEAVGQLGGADRATPKGVLRVMGVQGLTIYHVKSHLQKYRL 123
              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.24266126IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-3267124IPR009057Homeodomain-like
SuperFamilySSF466891.4E-1768123IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-2569124IPR006447Myb domain, plants
PfamPF002498.0E-971122IPR001005SANT/Myb domain
PfamPF143793.8E-24151198IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MLYEALKQST TKMSQHQRPS LPSPSPHHHQ ALSDPQRIAS GSSPGATSSG GGGGASSNAV  60
SNAAAAAAKQ RLRWTPDLHE RFVEAVGQLG GADRATPKGV LRVMGVQGLT IYHVKSHLQK  120
YRLAKYIPDP MGDGKSDKRR HPDLPSLGGS VQINEALRMQ MEVQKRLQEQ LEVQRHLQLR  180
IEAQGKYLQK IIDEQKKMSG GLDNQPGASP GSTQVFSSDI TVQGSDLKYE LTESVPGLMD  240
PPGGGGGGAL PAITSALSAL GSMAANNSLS RENSPASVPN PLGASYTLLN NNNNNIRTDD  300
AVVVSPRHQE SVEEYLHSKS LQQQQQSYHH SSYLQCNTAG RLP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-2569126158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-2569126158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-2569126158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-2569126158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002988201.20.0uncharacterized protein LOC9636347
TrEMBLD8QX790.0D8QX79_SELML; Uncharacterized protein
STRINGEFJ353630.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.17e-64G2-like family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]