PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 402806
Common NameSELMODRAFT_402806
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 272aa    MW: 30770.5 Da    PI: 10.2616
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
402806genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like781.1e-24115168155
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
              k++++W+p+LH+ Fv+ ve+L G ekA+P++ile+m+v++Lt+++v+SHLQkYR 
   402806 115 KTKVDWNPDLHRLFVQTVEEL-GLEKAIPSRILEIMGVESLTRHNVASHLQKYRA 168
              6799*****************.********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.97E-15112171IPR009057Homeodomain-like
PROSITE profilePS5129411.732112171IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-23113172IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-23115169IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAITMQGIAV RFMFLKVDFP IAKFFKQAGS VLEFLLVRLI VMYEKKQWEI KSYAGESVNG  60
QLTSSNDEVT LDDELESIQR SASDHSGTVD AAQQEQHMQR VENCRKKERS LTTKKTKVDW  120
NPDLHRLFVQ TVEELGLEKA IPSRILEIMG VESLTRHNVA SHLQKYRAQR KRKRAESKQK  180
CSSLEPLNKR DCLHIQPSPS IPSTCLAMYG DSLLKNSISA WQTTGPPAKH SRNANKDESR  240
VRSKLSLPMG LKPPMIAGLI EELRKLAQRA K*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-14114172462ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024532749.11e-106transcription factor BOA
RefseqXP_024532755.11e-106transcription factor BOA
TrEMBLD8QN410.0D8QN41_SELML; Uncharacterized protein
STRINGEFJ380410.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP28401529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44190.17e-21GOLDEN2-like 2
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]