PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 402040
Common NameSELMODRAFT_402040
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 397aa    MW: 44807.1 Da    PI: 5.2782
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
402040genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.99.7e-33228283156
  G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
              k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
   402040 228 KARRCWSPELHRRFVNALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 283
              68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-29225286IPR009057Homeodomain-like
SuperFamilySSF466895.78E-18225286IPR009057Homeodomain-like
PROSITE profilePS5129413.487225285IPR017930Myb domain
TIGRFAMsTIGR015573.5E-27228283IPR006447Myb domain, plants
PfamPF002491.4E-7230281IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MNPEEEFGQA EGPDLTLGCA IAKRDSSDQQ TRRRMEDYLQ ALQQERQKIE AFKRELPCCM  60
NLLDQAIQST RGCLDESYKT EMEEENPPKL ELFLENRSGF RLGKPKSEAE DHRDFEERPS  120
TPKQNWMQLA CFPSQSPRED EEFETRKALR SSTASADSGA FAPFVRDKKW DQAELCLSSS  180
ICLSLEQKKT GFIKFQGNES NLPLVELSLQ QMPSSGICSN STLHQQRKAR RCWSPELHRR  240
FVNALQQLGG SQVATPKQIR ELMKVDGLTN DEVKSHLQKY RLHTRRPATV APGTAAQKSP  300
QVVVLGSIWV PPEYAVFDHH QAAPSMQSTP LQQSKAQDFF ANLHASPAEP MVFYEKQELL  360
KSSKEEGEVL SPRKASATTA SEEEDDGDVT EAEEQR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-14228281154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14228281154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14228281154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14228281154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14228281255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002960068.10.0transcription factor HHO2
TrEMBLD8QPE30.0D8QPE3_SELML; Uncharacterized protein
STRINGEFJ376070.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.14e-59G2-like family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]