PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 39810
Common NameSELMODRAFT_39807, SELMODRAFT_39810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 55aa    MW: 6284.29 Da    PI: 10.9248
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
39810genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding506.9e-161855140
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqc 40
                     r+++T+eEd  +v+a++ +G++ W++Iar+++ gRt++ +
            39810 18 RKPFTEEEDRAIVKAHAIHGNK-WASIARMLP-GRTDNAI 55
                     789*******************.*********.****975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-9125IPR009057Homeodomain-like
SuperFamilySSF466892.14E-18255IPR009057Homeodomain-like
PROSITE profilePS5129422.0441355IPR017930Myb domain
SMARTSM007171.5E-51755IPR001005SANT/Myb domain
PfamPF002491.1E-131855IPR001005SANT/Myb domain
CDDcd001672.79E-102055No hitNo description
Gene3DG3DSA:1.10.10.603.8E-162655IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 55 aa     Download sequence    Send to blast
GKSCRLRWCN QLNPVVKRKP FTEEEDRAIV KAHAIHGNKW ASIARMLPGR TDNAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-211554296B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002972038.15e-35hypothetical protein SELMODRAFT_39810, partial
RefseqXP_002972584.15e-35hypothetical protein SELMODRAFT_39807, partial
SwissprotO497827e-23MYB51_ARATH; Transcription factor MYB51
SwissprotQ9FDW14e-23MYB44_ARATH; Transcription factor MYB44
TrEMBLD8RLN85e-35D8RLN8_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ269552e-34(Selaginella moellendorffii)
STRINGEFJ266702e-34(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.13e-28myb domain protein 109
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]