PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 39516
Common NameMYB4B-1, MYB4B-2, SELMODRAFT_39507, SELMODRAFT_39516
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 87aa    MW: 9962.54 Da    PI: 9.5152
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
39516genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd+ll + + ++G g+W+t ++  g++R++k+c++rw +yl
            39516 14 RGPWTREEDLLLTQHISLHGEGSWRTLPKAAGLRRCGKSCRLRWINYL 61
                     89********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.5E-24564IPR009057Homeodomain-like
PROSITE profilePS5129422.858965IPR017930Myb domain
SMARTSM007171.3E-121363IPR001005SANT/Myb domain
PfamPF002494.1E-151461IPR001005SANT/Myb domain
SuperFamilySSF466892.12E-221587IPR009057Homeodomain-like
CDDcd001671.65E-91661No hitNo description
Gene3DG3DSA:1.10.10.601.7E-86587IPR009057Homeodomain-like
PROSITE profilePS512948.7726687IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MGRAPCCEKV GLNRGPWTRE EDLLLTQHIS LHGEGSWRTL PKAAGLRRCG KSCRLRWINY  60
LRPDLKRGNI SEEEDQLIIK LHSLLGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-1612872599MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002961794.16e-58hypothetical protein SELMODRAFT_39516, partial
RefseqXP_002964867.16e-58hypothetical protein SELMODRAFT_39507, partial
SwissprotQ9S9K92e-45MYB3_ARATH; Transcription factor MYB3
TrEMBLD8QT486e-58D8QT48_SELML; Putative uncharacterized protein MYB4B-1 (Fragment)
STRINGEFJ337052e-57(Selaginella moellendorffii)
STRINGEFJ370542e-57(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.11e-46myb domain protein 3
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]