PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 37441
Common NameSELMODRAFT_37438, SELMODRAFT_37441
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family CPP
Protein Properties Length: 116aa    MW: 13077 Da    PI: 7.6435
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
37441genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR22.72e-071251742
    TCR 17 YCeCfaagkkCseeCkCedCkNkeek 42
           YCeCfa+g++C+  C+C +C N++e+
  37441  1 YCECFASGVYCDG-CNCLNCWNNSEN 25
           *************.********9985 PP

2TCR52.21.2e-1679116138
    TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkN 38 
            +++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dC+N
  37441  79 RHNKGCQCKKSGCLKKYCECFQANILCSENCRCVDCRN 116
            589*********************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011140.024125IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163430.8571116IPR005172CRC domain
PfamPF036381.2E-4122IPR005172CRC domain
SMARTSM011144.0E-1579116IPR033467Tesmin/TSO1-like CXC domain
PfamPF036387.3E-1382116IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 116 aa     Download sequence    Send to blast
YCECFASGVY CDGCNCLNCW NNSENEKVRQ EAVELALERN PNAFRPKIGS KSVSVSDFLI  60
CVFSLIQELV REPQATVARH NKGCQCKKSG CLKKYCECFQ ANILCSENCR CVDCRN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002972148.12e-79hypothetical protein SELMODRAFT_37441, partial
RefseqXP_002977468.12e-79hypothetical protein SELMODRAFT_37438, partial
SwissprotQ9SL704e-47TCX6_ARATH; Protein tesmin/TSO1-like CXC 6
TrEMBLD8RL413e-79D8RL41_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ214728e-79(Selaginella moellendorffii)
STRINGEFJ270658e-79(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14691745
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G20110.12e-48Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]