PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 35907
Common NameSELMODRAFT_35907
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 133aa    MW: 15316.8 Da    PI: 10.6934
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
35907genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.61.6e-34761155
  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
             kprlrWtpeLHerFveav+qLGG+ekAtPk+++++m+vkgLtl+h+kSHLQk+Rl
    35907  7 KPRLRWTPELHERFVEAVTQLGGAEKATPKSVMRIMGVKGLTLYHLKSHLQKFRL 61
             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.009464IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-33562IPR009057Homeodomain-like
SuperFamilySSF466891.34E-17662IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-24762IPR006447Myb domain, plants
PfamPF002495.4E-9959IPR001005SANT/Myb domain
PfamPF143796.6E-2685131IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
ISASEPKPRL RWTPELHERF VEAVTQLGGA EKATPKSVMR IMGVKGLTLY HLKSHLQKFR  60
LGKQLNKDTN VANRNACPHH FASSQITEAL RLQMEVQKKL HEQLEVQRHL QLRIEAQGKY  120
LQALLEKARE TFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-24763157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-24763157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-24763157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-24763157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024540307.15e-79protein PHR1-LIKE 3
SwissprotQ94A578e-58PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLD8S8641e-92D8S864_SELML; Uncharacterized protein (Fragment)
STRINGEFJ193632e-93(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-60G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]