PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29567
Common NameSELMODRAFT_29567
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Dof
Protein Properties Length: 61aa    MW: 7239.09 Da    PI: 10.1215
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29567genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof66.44.7e-21761357
  zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
            ++  +cprC+s nt+f yynn    qPr+ C+aC++ Wt+GG +r    Gg +rk
   29567  7 DNVYQCPRCQSYNTRFDYYNNEKRDQPRFACRACKKQWTQGGKIRAASSGGRKRK 61
            67889******************************************99998887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-11661IPR003851Zinc finger, Dof-type
PfamPF027012.1E-27761IPR003851Zinc finger, Dof-type
PROSITE profilePS5088419.7871061IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 61 aa     Download sequence    Send to blast
EPHELPDNVY QCPRCQSYNT RFDYYNNEKR DQPRFACRAC KKQWTQGGKI RAASSGGRKR  60
K
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024523888.14e-39dof zinc finger protein DOF3.1-like
SwissprotQ9FZA46e-14DOF14_ARATH; Dof zinc finger protein DOF1.4
TrEMBLD8QY074e-38D8QY07_SELML; Uncharacterized protein (Fragment)
STRINGEFJ351207e-39(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.22e-16Dof family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]