PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29451
Common NameLHY, SELMODRAFT_19475, SELMODRAFT_29451
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 85aa    MW: 10010.5 Da    PI: 10.5849
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29451genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.94.9e-181256147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE++++++a k++G   W++I +++g ++t+ q++s+ qk+
            29451 12 RERWTEEEHQKFLEALKLYGRA-WRRIEEHIG-TKTAVQIRSHAQKF 56
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.65E-18662IPR009057Homeodomain-like
PROSITE profilePS5129421.854761IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.8E-11961IPR009057Homeodomain-like
TIGRFAMsTIGR015572.3E-181059IPR006447Myb domain, plants
SMARTSM007172.0E-131159IPR001005SANT/Myb domain
PfamPF002492.6E-151255IPR001005SANT/Myb domain
CDDcd001673.35E-101457No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010243Biological Processresponse to organonitrogen compound
GO:0010600Biological Processregulation of auxin biosynthetic process
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043496Biological Processregulation of protein homodimerization activity
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
QVRKPYTITK QRERWTEEEH QKFLEALKLY GRAWRRIEEH IGTKTAVQIR SHAQKFFSKL  60
EKEQATGSIV PGTAQDIDIP PPRPK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00654PBMTransfer from LOC_Os08g06110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002964171.11e-56hypothetical protein SELMODRAFT_29451, partial
RefseqXP_002988893.11e-56hypothetical protein SELMODRAFT_19475, partial
SwissprotF4KGY66e-35RVE1_ARATH; Protein REVEILLE 1
SwissprotP929736e-35CCA1_ARATH; Protein CCA1
TrEMBLD8R0141e-56D8R014_SELML; Putative uncharacterized protein LHY (Fragment)
STRINGEFJ101554e-56(Selaginella moellendorffii)
STRINGEFJ345044e-56(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12551549
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.13e-36MYB_related family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]