PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 28794
Common NameSELMODRAFT_7330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family TCP
Protein Properties Length: 50aa    MW: 5706.55 Da    PI: 10.161
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
28794genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP88.31.7e-271501362
    TCP 13 TkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikel 62
           T++g+RdRRvRls+ +a++f+d+qd+LG+d++sk++eWLl++ak+ai++l
  28794  1 TSKGLRDRRVRLSVATAIQFYDVQDRLGYDQPSKAVEWLLKKAKAAIDDL 50
           99*********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.8E-25150IPR005333Transcription factor, TCP
PROSITE profilePS5136928.341150IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 50 aa     Download sequence    Send to blast
TSKGLRDRRV RLSVATAIQF YDVQDRLGYD QPSKAVEWLL KKAKAAIDDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-22150554Putative transcription factor PCF6
5zkt_B1e-22150554Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024522990.14e-26uncharacterized protein LOC112343562
RefseqXP_024522991.14e-26uncharacterized protein LOC112343562
RefseqXP_024522992.14e-26uncharacterized protein LOC112343562
RefseqXP_024522993.14e-26uncharacterized protein LOC112343562
SwissprotO822774e-23TCP10_ARATH; Transcription factor TCP10
TrEMBLD8RQ845e-27D8RQ84_SELML; Uncharacterized protein (Fragment)
TrEMBLD8TDH05e-27D8TDH0_SELML; Uncharacterized protein (Fragment)
STRINGEFJ053348e-28(Selaginella moellendorffii)
STRINGEFJ256148e-28(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP18015163
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G31070.11e-25TCP domain protein 10
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  2. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]
  3. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]