PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 24518
Common NameSELMODRAFT_14382, SELMODRAFT_24518
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Trihelix
Protein Properties Length: 213aa    MW: 25582.2 Da    PI: 10.0118
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
24518genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix93.42.2e-29126208186
  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
               rW++ ev+aLi++r  me+++++   k+p Wee+s+ ++ +g++rs+k+Ckekwen+nk+y+k+ + ++    e+++tcpyf++l+
     24518 126 RWPRAEVQALIQLRAAMETKFQEVGPKGPFWEEISAGLACQGYSRSAKRCKEKWENINKYYRKTSTKKRP---ENTKTCPYFQELD 208
               8***************************************************************998885...78899******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.1E-4123185IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-5124182IPR009057Homeodomain-like
PfamPF138374.0E-21125209No hitNo description
CDDcd122031.57E-24125189No hitNo description
PROSITE profilePS500907.143126183IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
KKRKRKSWKE RMAFFENLVK KFMEKQEQMQ QNFLELLEKR EQERMKRDET WRKQEVARLN  60
REYELRVEEH TRRINYDTAL ASALQKATGQ VLEMPHQGPV PSPYSNTLAE SNDDHHKEVC  120
DSMNKRWPRA EVQALIQLRA AMETKFQEVG PKGPFWEEIS AGLACQGYSR SAKRCKEKWE  180
NINKYYRKTS TKKRPENTKT CPYFQELDVL YQK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024527162.11e-155trihelix transcription factor GT-2-like
RefseqXP_024527164.11e-155trihelix transcription factor GT-2-like
TrEMBLD8R5N91e-157D8R5N9_SELML; Uncharacterized protein (Fragment)
STRINGEFJ166981e-158(Selaginella moellendorffii)
STRINGEFJ325151e-158(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6631573
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.23e-50Trihelix family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]