PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 19630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family Dof
Protein Properties Length: 59aa    MW: 6880 Da    PI: 10.5282
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
19630genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-39459257
  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57
            +++ lkcprC+s ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rk
   19630  4 PNQVLKCPRCNSLNTKFCYYNNYSLTQPRHFCKNCRRYWTKGGALRNVPIGGGCRK 59
            78999**************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-24259IPR003851Zinc finger, Dof-type
PfamPF027011.4E-33659IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.059859IPR003851Zinc finger, Dof-type
PROSITE patternPS0136101046IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 59 aa     Download sequence    Send to blast
KPQPNQVLKC PRCNSLNTKF CYYNNYSLTQ PRHFCKNCRR YWTKGGALRN VPIGGGCRK
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024536180.16e-39dof zinc finger protein DOF2.4-like, partial
RefseqXP_024539523.16e-39dof zinc finger protein DOF2.4-like, partial
SwissprotQ8LDR01e-31DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLD8R3A87e-33D8R3A8_SELML; Uncharacterized protein
TrEMBLD8RWQ92e-35D8RWQ9_SELML; Uncharacterized protein (Fragment)
STRINGEFJ203023e-36(Selaginella moellendorffii)
STRINGEFJ232993e-36(Selaginella moellendorffii)
STRINGEFJ332431e-33(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.16e-34OBF binding protein 4
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Xu P,Chen H,Ying L,Cai W
    AtDOF5.4/OBP4, a DOF Transcription Factor Gene that Negatively Regulates Cell Cycle Progression and Cell Expansion in Arabidopsis thaliana.
    Sci Rep, 2016. 6: p. 27705
    [PMID:27297966]
  3. Ramirez-Parra E, et al.
    The transcription factor OBP4 controls root growth and promotes callus formation.
    New Phytol., 2017. 213(4): p. 1787-1801
    [PMID:27859363]
  4. Rymen B, et al.
    ABA Suppresses Root Hair Growth via the OBP4 Transcriptional Regulator.
    Plant Physiol., 2017. 173(3): p. 1750-1762
    [PMID:28167701]