PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 149357
Common NameSELMODRAFT_149357
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family G2-like
Protein Properties Length: 274aa    MW: 30096 Da    PI: 7.3738
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
149357genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.91.3e-344397155
  G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
             kprlrWtpeLHerFveav+qLGG++kAtPk+++++m+vkgLtl+h+kSHLQkYRl
   149357 43 KPRLRWTPELHERFVEAVTQLGGADKATPKSVMRVMGVKGLTLYHLKSHLQKYRL 97
             79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.19240100IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-344199IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-244397IPR006447Myb domain, plants
SuperFamilySSF466899.85E-184399IPR009057Homeodomain-like
PfamPF002491.8E-94596IPR001005SANT/Myb domain
PfamPF143794.1E-24135179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0016036Biological Processcellular response to phosphate starvation
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MYQMKKYPSP QLIPHRGGAM PAQSEPLYIA SGGDSVVSSI EPKPRLRWTP ELHERFVEAV  60
TQLGGADKAT PKSVMRVMGV KGLTLYHLKS HLQKYRLGMQ MHKENNGDGK KEGGAKAQTT  120
GSQNSMNSNL SDGYEINRAL SMQMEVQRKL HEQLEVQKHL QLRIEAQSKY LQNILEKARD  180
AFVGHIPTSA ELEAAHAELT ELAKGTLEGF EFTVPPLPEL PSPSSETKAA NQTPAAPTGK  240
KSTTSNLTLN QQQQQRDGQE LDSDQAAEID ITT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-224396154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-224396154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-224396154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-224396154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-224396255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00378DAPTransfer from AT3G24120Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002974030.10.0protein PHR1-LIKE 2 isoform X2
SwissprotQ8LAJ78e-65PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLD8RS140.0D8RS14_SELML; Uncharacterized protein
STRINGEFJ249850.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP7817262
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.13e-58G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]
  3. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]