PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 139506
Common NameSELMODRAFT_437369, Sm_DELLA1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRAS
Protein Properties Length: 513aa    MW: 55490.9 Da    PI: 5.2531
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
139506genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS449.12.9e-1371425101374
    GRAS   1 lvelLlecAeavssgdlelaqalLarlsel...aspdgdpmqRlaayfteALaarlarsvselykal.ppsetseknsseelaalklfsevsPilkfshltaN 99 
             lv+lLl+cA+av+ gdl++a  ++a+l+ l    s++ ++m R+a+ f+eAL++r+++   ++y+    p +t++  ++e l++   f+e++P+lkf+h+taN
  139506 142 LVHLLLACANAVQRGDLAAAGDMVAQLRILvahPSSSSSAMARVATQFVEALSRRIQN---SCYNESsDPGNTNNGAMDEILHF--HFYETCPYLKFAHFTAN 239
             68*************************988754677779******************9...66665524444444445555555..5**************** PP

    GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEal 202
             qaIlea+eg++ vH++D+d+++GlQWpaL+qaLa Rp+gpp+lR+Tg+g+p++++++ l+e+g +La++A++++v+f f+ +va rl+d+++++L v++gEa+
  139506 240 QAILEALEGHKSVHVVDLDLQYGLQWPALIQALALRPGGPPTLRLTGIGPPQPHRHDLLHEIGLKLAQLADSVNVDFAFHGVVAARLNDVQPWMLTVRRGEAV 342
             ******************************************************************************************************* PP

    GRAS 203 aVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl.eaklpreseerikvErellgreivnvvacegae 304
             aVn+v+q+h+ l e+ ++    devL+lv++l+Pk+v++veq+adhns+ F+erf+ al+yys++fdsl + +l++ s e+++ E   lg+ei n+vacega+
  139506 343 AVNSVFQMHKALVEEPPI----DEVLRLVRNLKPKIVTLVEQDADHNSPVFMERFMAALHYYSTMFDSLeACNLAPGSVEQMVAETY-LGQEIGNIVACEGAA 440
             ************555555....55*********************************************667888888777777766.*************** PP

    GRAS 305 rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
             r+erhetl +Wr r+ ++GF+p+ l+++a kqa++ll  +++dgyrvee++g+l+lgW++rpLv++SaW+
  139506 441 RTERHETLTQWRIRMARSGFQPLYLGSNAFKQANMLLTLFSGDGYRVEEKDGCLTLGWHSRPLVAASAWE 510
             *********************************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120418.3E-28469IPR021914Transcriptional factor DELLA, N-terminal
SMARTSM011294.7E-17475No hitNo description
PROSITE profilePS5098566.19116490IPR005202Transcription factor GRAS
PfamPF035141.0E-134142510IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006808Biological Processregulation of nitrogen utilization
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009863Biological Processsalicylic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0010187Biological Processnegative regulation of seed germination
GO:0010218Biological Processresponse to far red light
GO:0010233Biological Processphloem transport
GO:0042538Biological Processhyperosmotic salinity response
GO:1903506Biological Processregulation of nucleic acid-templated transcription
GO:2000033Biological Processregulation of seed dormancy process
GO:2000377Biological Processregulation of reactive oxygen species metabolic process
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 513 aa     Download sequence    Send to blast
MGMDELLAHA GYNVRASDLT HVAQRIEELD SLLGAAAPAD ILAQDTVHYN PSDLVSWIEG  60
MLDELVPQQP TATSSSDMES VNEVGVVASH SQIAASTTPR PASGSSSSTS PHGIPPHAAG  120
GMTSAAAMPT IQESDELSGV RLVHLLLACA NAVQRGDLAA AGDMVAQLRI LVAHPSSSSS  180
AMARVATQFV EALSRRIQNS CYNESSDPGN TNNGAMDEIL HFHFYETCPY LKFAHFTANQ  240
AILEALEGHK SVHVVDLDLQ YGLQWPALIQ ALALRPGGPP TLRLTGIGPP QPHRHDLLHE  300
IGLKLAQLAD SVNVDFAFHG VVAARLNDVQ PWMLTVRRGE AVAVNSVFQM HKALVEEPPI  360
DEVLRLVRNL KPKIVTLVEQ DADHNSPVFM ERFMAALHYY STMFDSLEAC NLAPGSVEQM  420
VAETYLGQEI GNIVACEGAA RTERHETLTQ WRIRMARSGF QPLYLGSNAF KQANMLLTLF  480
SGDGYRVEEK DGCLTLGWHS RPLVAASAWE CC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-501425104375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2627440.0Selaginella moellendorffii putative DELLA protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002960248.10.0GRAS-family protein
SwissprotQ8S4W71e-172GAI1_VITVI; DELLA protein GAI1
TrEMBLA9LY090.0A9LY09_SELML; GRAS-family protein
STRINGEFJ377870.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14920.11e-165GRAS family protein
Publications ? help Back to Top
  1. Hirano K, et al.
    The GID1-mediated gibberellin perception mechanism is conserved in the Lycophyte Selaginella moellendorffii but not in the Bryophyte Physcomitrella patens.
    Plant Cell, 2007. 19(10): p. 3058-79
    [PMID:17965273]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]