PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 133546
Common NameSELMODRAFT_133546, SELMODRAFT_137652
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 176aa    MW: 19287.8 Da    PI: 11.5616
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
133546genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.74.8e-1299143347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W +eE+ l++ + + lG+g+W+ I+r   + Rt+ q+ s+ qky
           133546  99 PWREEEHRLFLVGLHALGKGDWRGISRNYVTSRTPTQVASHAQKY 143
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501589.125320IPR001878Zinc finger, CCHC-type
Gene3DG3DSA:4.10.60.109.2E-5321IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129416.66992148IPR017930Myb domain
SuperFamilySSF466897.41E-1693149IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-1695147IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.604.8E-996142IPR009057Homeodomain-like
SMARTSM007178.4E-996146IPR001005SANT/Myb domain
PfamPF002491.6E-999143IPR001005SANT/Myb domain
CDDcd001673.49E-899144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 176 aa     Download sequence    Send to blast
MARRCSHCGH NGHNSRTCPD RGIRLFGVRL TMKATDGASG VAMRRSASAG NLVTMQAIAT  60
PTSSSAVASE QSESGGDGYA SDGLVQASSY ARARKKGVPW REEEHRLFLV GLHALGKGDW  120
RGISRNYVTS RTPTQVASHA QKYFIRQSNL TKRKRRSSLF DISPEVRRSI HLFFH*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002991458.11e-128hypothetical protein SELMODRAFT_133546
RefseqXP_002993844.11e-128hypothetical protein SELMODRAFT_137652
SwissprotQ8S9H79e-32DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD8T7741e-128D8T774_SELML; Putative uncharacterized protein
STRINGEFJ050811e-127(Selaginella moellendorffii)
STRINGEFJ075701e-127(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3941699
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-67MYB_related family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]