PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 127390
Common NameSELMODRAFT_127390
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family MYB_related
Protein Properties Length: 68aa    MW: 7521.75 Da    PI: 8.3399
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
127390genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.21.2e-101445132
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg 32
                     rg+WT eEd ll ++v+++G g+W+t +   g
           127390 14 RGPWTREEDTLLTQYVNEHGEGSWRTLPMAAG 45
                     89***********************9876655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-11541IPR009057Homeodomain-like
SuperFamilySSF466895.1E-9845IPR009057Homeodomain-like
PROSITE profilePS500907.085940IPR017877Myb-like domain
PfamPF002493.0E-81440IPR001005SANT/Myb domain
CDDcd001679.03E-61638No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 68 aa     Download sequence    Send to blast
MGRSPCCEKI GLNRGPWTRE EDTLLTQYVN EHGEGSWRTL PMAAGLIRPN LIPLLVSTFS  60
KIFCRGC*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002988116.13e-44hypothetical protein SELMODRAFT_127390
SwissprotP278983e-19MYBP_MAIZE; Myb-related protein P
TrEMBLD8SXL94e-44D8SXL9_SELML; Putative uncharacterized protein
STRINGEFJ109081e-43(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.15e-20myb domain protein 111
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]