PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 12696
Common NameSELMODRAFT_12699
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRAS
Protein Properties Length: 393aa    MW: 44663.8 Da    PI: 5.3904
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
12696genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS309.29.5e-9563932373
   GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl........fsevsPilkfshlt 97 
            ++lLl+cA+a++s+d++ aq++++ l+++a+ dgdp+qR+aa f++AL +r++  +s+ ++ ++ s  + + ss + +  +l        f++++P+++f++ +
  12696   6 EQLLLHCATALESSDTTFAQQIMWVLNNIAAFDGDPNQRVAAWFLKALVSRVLL-CSRFSQVFQDSCLNLDASSASCFDNRLltpiqlakFVDLTPWHRFGFSA 108
            689*************************************************97.77777777666666555555555554445556689************** PP

   GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegpp.slRiTgvgspesg...skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvk 197
            aN aIleav++ +++Hi+D++i++++QWp+L+++L++Rp+gpp s+R+ ++ +  s+       +ee+g rL+ fA++ +v++ef+v+   + +dl +  ++++
  12696 109 ANGAILEAVQSRDKIHILDLSITHCMQWPTLIESLSNRPGGPPnSVRLSVLTARPSVppfVDMPYEELGTRLRTFARSKRVNLEFEVV---SSSDLIPGLFQIR 209
            ***************************************99888*******9977778889999***********************7...6688889****** PP

   GRAS 198 p.gEalaVnlvlqlhrll.........desvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellg 291
              +Eal+Vn++l+lh+++          +++ l+s+rde+L+l++sl+P++v++ve++ad +s+s+++r+  a ++ +  fd le+ l+r++e r  +E+  +g
  12696 210 DgDEALVVNCQLRLHYFPeiddhddphLDHHGLSSPRDEILHLIRSLNPDMVTLVEEDADVTSPSLVDRLRAAYNHLWIPFDLLESCLARNHELRLQYEAD-VG 312
            999***************999998888677778889*****************************************************************.** PP

   GRAS 292 reivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
            r+i n+vaceg++r+er e+  kW++r++ aGF+++ + +++  ++k +l++++  g+ ++ + + l+l+Wk++++v+++aW
  12696 313 RKIDNIVACEGEARIERLESRDKWNQRMRFAGFRQLGFCDEVWGDVKWMLEQHA-TGWGLKRDAHDLLLTWKGHNVVFATAW 393
            ******************************************************.99************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.6051375IPR005202Transcription factor GRAS
PfamPF035143.3E-926393IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
DAACVEQLLL HCATALESSD TTFAQQIMWV LNNIAAFDGD PNQRVAAWFL KALVSRVLLC  60
SRFSQVFQDS CLNLDASSAS CFDNRLLTPI QLAKFVDLTP WHRFGFSAAN GAILEAVQSR  120
DKIHILDLSI THCMQWPTLI ESLSNRPGGP PNSVRLSVLT ARPSVPPFVD MPYEELGTRL  180
RTFARSKRVN LEFEVVSSSD LIPGLFQIRD GDEALVVNCQ LRLHYFPEID DHDDPHLDHH  240
GLSSPRDEIL HLIRSLNPDM VTLVEEDADV TSPSLVDRLR AAYNHLWIPF DLLESCLARN  300
HELRLQYEAD VGRKIDNIVA CEGEARIERL ESRDKWNQRM RFAGFRQLGF CDEVWGDVKW  360
MLEQHATGWG LKRDAHDLLL TWKGHNVVFA TAW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-2823931374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002989022.10.0hypothetical protein SELMODRAFT_12699, partial
TrEMBLD8T0A90.0D8T0A9_SELML; Putative uncharacterized protein (Fragment)
STRINGEFJ098160.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-116GRAS family protein
Publications ? help Back to Top
  1. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]