PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 122441
Common NameSELMODRAFT_450795, Sm_DELLA2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Lycopodiidae; Selaginellales; Selaginellaceae; Selaginella
Family GRAS
Protein Properties Length: 456aa    MW: 50522.8 Da    PI: 5.0727
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
122441genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.31.5e-1071024541374
    GRAS   1 lvelLlecAeavssgdle..laqalLarlselaspdgd...pmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlta 98 
             l++lL++c  ++  +d +  +a+++L +++ l  + gd   ++ R+aayf+e+L++r++        +lp+ +++    +   a+l+ f+ ++P+lkf+h+ta
  122441 102 LIHLLFACGACLGREDDKsaKAEEFLDQIRMLLLSMGDsagAIGRVAAYFVEGLSRRILF------GSLPAAQAE----EADPAFLESFYRTCPFLKFGHFTA 194
             689******99977554434999********9666555344899**************97......677777776....344466789*************** PP

    GRAS  99 NqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
             Nqa++e++e+e+ vHiiDf+ + G+QWp+L+q La Rp+gppslR+T++++   + + ++++tg+rLa+fA+++gv+++f+++  +     ++ +  v pgEa
  122441 195 NQAMYEELEEERSVHIIDFEFGLGVQWPPLIQMLAIRPGGPPSLRLTAIAP--DHLQFQVHHTGNRLARFAASIGVDLQFQTV--N-----SIASVLVYPGEA 288
             ***************************************************..55999***********************96..3.....345556****** PP

    GRAS 202 laVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegae 304
             laVn++l+lhrl+d+        d+vL  v++lsPk++++ eq+a+hns++F +rf e+l+yysa+fds+ +++++ +++    E++ lgreivn++aceg++
  122441 289 LAVNSMLHLHRLVDD------SLDSVLASVRRLSPKIFTLLEQDASHNSPDFDNRFNECLHYYSAIFDSIYQQFGQVEQAVLESEAH-LGREIVNILACEGRA 384
             ************933......3567*********************************************99998888887777777.*************** PP

    GRAS 305 rrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
             r+erhe+le+W +r++ +GFkp +l+++a++qa + l  +++ g++++e  g+l+lgW++r+L+++SaWr
  122441 385 RVERHERLEQWTRRMSGMGFKPRHLGSNAYNQAATFLTIFPGGGHTIQETAGCLTLGWQSRTLFAASAWR 454
             *********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF120414.9E-5933IPR021914Transcriptional factor DELLA, N-terminal
PROSITE profilePS5098551.08776434IPR005202Transcription factor GRAS
PfamPF035145.1E-105102454IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MERLESLGVE RFDQDAVHSN PSDISGWIDS LIEQQTRGSP LDSQQDNTSS SPSPPSLLIS  60
CPHDSSRIAT TTTTTNALPL HMIHTQPDDE QQDDQEANGL KLIHLLFACG ACLGREDDKS  120
AKAEEFLDQI RMLLLSMGDS AGAIGRVAAY FVEGLSRRIL FGSLPAAQAE EADPAFLESF  180
YRTCPFLKFG HFTANQAMYE ELEEERSVHI IDFEFGLGVQ WPPLIQMLAI RPGGPPSLRL  240
TAIAPDHLQF QVHHTGNRLA RFAASIGVDL QFQTVNSIAS VLVYPGEALA VNSMLHLHRL  300
VDDSLDSVLA SVRRLSPKIF TLLEQDASHN SPDFDNRFNE CLHYYSAIFD SIYQQFGQVE  360
QAVLESEAHL GREIVNILAC EGRARVERHE RLEQWTRRMS GMGFKPRHLG SNAYNQAATF  420
LTIFPGGGHT IQETAGCLTL GWQSRTLFAA SAWRC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-4014645442375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU2627450.0Selaginella moellendorffii putative DELLA protein mRNA, complete cds
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002985540.10.0GRAS-family protein
TrEMBLD8SQ860.0D8SQ86_SELML; GRAS-family protein
STRINGEFJ134140.0(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12511550
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.12e-97RGA-like 2
Publications ? help Back to Top
  1. Hirano K, et al.
    The GID1-mediated gibberellin perception mechanism is conserved in the Lycophyte Selaginella moellendorffii but not in the Bryophyte Physcomitrella patens.
    Plant Cell, 2007. 19(10): p. 3058-79
    [PMID:17965273]
  2. Banks JA, et al.
    The Selaginella genome identifies genetic changes associated with the evolution of vascular plants.
    Science, 2011. 332(6032): p. 960-3
    [PMID:21551031]