PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029269-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family GRF
Protein Properties Length: 280aa    MW: 30959.9 Da    PI: 7.836
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029269-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.4e-25105149145
                    WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                            d+epgrC+RtDGKkWRCsr+v + +k+CErHlhrgr rsrk++e+
  SMil_00029269-RA_Salv 105 DPEPGRCKRTDGKKWRCSREVAPQQKYCERHLHRGRPRSRKPVEP 149
                            79****************************************996 PP

2QLQ55.41.9e-195891235
                    QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35
                           +FT aQ+q+L++Q+++yK++++ +PvPp+Ll+++
  SMil_00029269-RA_Salv 58 PFTGAQWQELERQAMIYKCMISCVPVPPHLLFPL 91
                           8******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.3E-125793IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.1215893IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-135891IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.156105149IPR014977WRC domain
PfamPF088791.8E-20106148IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MDSVLDTKTS LNTDFLGWMK STATGSNISH HPHPPFSLGD AHDDGTTPAG GGVAAGFPFT  60
GAQWQELERQ AMIYKCMISC VPVPPHLLFP LDSSFPCGRY SRKGDPEPGR CKRTDGKKWR  120
CSREVAPQQK YCERHLHRGR PRSRKPVEPN KKTRVEHTKT PPKTDYKETN SSKQPWMGPL  180
QEDLNLLSYS YPEMDVAGGF IDERDVSLDL SMAMAVGKQI DNDFDAAKWL SPVSWERGGP  240
LAEALSPATT VSSPSGVLHR TLFSHSDGSV CNSPTATFWL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011084560.11e-73growth-regulating factor 7-like isoform X1
RefseqXP_011084563.11e-73growth-regulating factor 7-like isoform X3
TrEMBLA0A2G9HZL02e-68A0A2G9HZL0_9LAMI; Uncharacterized protein
STRINGMigut.F00160.1.p7e-62(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.14e-34growth-regulating factor 7