PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00029259-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family HD-ZIP
Protein Properties Length: 239aa    MW: 27415.3 Da    PI: 4.7253
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00029259-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.72.3e-1970123356
                            --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            k++++t+eq++ Le+ F+ ++++  +++ eLAkklgL+ rqV +WFqNrRa+ k
  SMil_00029259-RA_Salv  70 KKRRLTAEQVQFLEKSFAVENKLEPDRKNELAKKLGLQPRQVAIWFQNRRARSK 123
                            56789***********************************************99 PP

2HD-ZIP_I/II124.64.4e-4069157189
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            ekkrrl++eqv++LE+sF  e+kLep+rK+ela++Lglqprqva+WFqnrRAR ktk lE++y +Lk++yd+lk++ ++L +++e+L+
  SMil_00029259-RA_Salv  69 EKKRRLTAEQVQFLEKSFAVENKLEPDRKNELAKKLGLQPRQVAIWFQNRRARSKTKVLEREYGSLKSCYDKLKADYDTLFSDNEKLK 156
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 e 89 
                            +
  SMil_00029259-RA_Salv 157 N 157
                            6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.78E-1954125IPR009057Homeodomain-like
PROSITE profilePS5007117.50865125IPR001356Homeobox domain
SMARTSM003891.2E-1868129IPR001356Homeobox domain
PfamPF000461.2E-1670123IPR001356Homeobox domain
CDDcd000861.53E-1670125No hitNo description
Gene3DG3DSA:1.10.10.602.7E-1971131IPR009057Homeodomain-like
PRINTSPR000311.6E-696105IPR000047Helix-turn-helix motif
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PRINTSPR000311.6E-6105121IPR000047Helix-turn-helix motif
PfamPF021836.9E-12125158IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MKSSPVFDVA DALLNDERIP SDALWIPNSS PSLHAMVSFE QSRGERSNRS RQSDCDDGDS  60
DSCFHHPPEK KRRLTAEQVQ FLEKSFAVEN KLEPDRKNEL AKKLGLQPRQ VAIWFQNRRA  120
RSKTKVLERE YGSLKSCYDK LKADYDTLFS DNEKLKNEKG NDEISPLDAA PCKQEDASSY  180
SSHVLEASDF EQGDEDDECL VQRLCLPKLE AEYYDDHLQP NSCNLGFPVQ NQGTWFWQC
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071034.11e-80homeobox-leucine zipper protein HAT5-like
TrEMBLA0A4D9APJ01e-125A0A4D9APJ0_SALSN; Homeobox-leucine zipper protein
STRINGMigut.L01347.1.p3e-63(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8252495
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-40homeobox 1