PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00028639-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family CO-like
Protein Properties Length: 334aa    MW: 36598.8 Da    PI: 5.8222
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00028639-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box23.98.5e-081143436
               zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                           + C+ ++  ++  fC+ ++ +lC  C  ++H  
  SMil_00028639-RA_Salv 11 KLCDSCKAAPAAVFCRADSAFLCGACDGKIHAA 43
                           68***************************9954 PP

2zf-B_box315.2e-105398342
               zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                            ++C+ +e+ ++++ C+ +   lC+ C   +H+       H++vp+
  SMil_00028639-RA_Salv 53 VWICEVCEQAPASFTCKADAASLCAACDRDIHSAnplarrHERVPV 98
                           689*****************************66899999*99986 PP

3CCT69.21.1e-23270314145
                    CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                            Rea++lRY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++e
  SMil_00028639-RA_Salv 270 REARVLRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRSE 314
                            9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.054855IPR000315B-box-type zinc finger
SMARTSM003364.1E-13855IPR000315B-box-type zinc finger
PfamPF006434.5E-61150IPR000315B-box-type zinc finger
CDDcd000211.34E-71255No hitNo description
PROSITE profilePS5011910.585198IPR000315B-box-type zinc finger
PfamPF006437.4E-85398IPR000315B-box-type zinc finger
CDDcd000211.00E-95498No hitNo description
SMARTSM003362.3E-105698IPR000315B-box-type zinc finger
PfamPF062031.4E-17270312IPR010402CCT domain
PROSITE profilePS5101716.797270312IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010099Biological Processregulation of photomorphogenesis
GO:0010161Biological Processred light signaling pathway
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MGAETWSLTA KLCDSCKAAP AAVFCRADSA FLCGACDGKI HAANKLASRH GRVWICEVCE  60
QAPASFTCKA DAASLCAACD RDIHSANPLA RRHERVPVVP FYDSAAKSSP SAECSEEEAE  120
AASWLLPDPN SKVEEESGSP EYMSAEYLFN DMDPYLDLDL KSGDQKPHHI VDDDHKHYSS  180
DGVVPVQSKT EYGSGHYVPG PVVDGFPTYE MEYPGPKPFM YNFTSQSISQ SVSSSSLEVG  240
VVPDHNGAAD ATESLGKSES VAVALFGMDR EARVLRYREK RKNRRFEKTI RYASRKAYAE  300
TRPRIKGRFA KRSELEVDSL LAADASSFVS LQRS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011082019.11e-167zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T91e-93COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A068L9I61e-178A0A068L9I6_9MYRT; Zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A4D9AM491e-178A0A4D9AM49_SALSN; Uncharacterized protein
STRINGMigut.A00403.1.p1e-162(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.16e-90CONSTANS-like 4