PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00027319-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 198aa    MW: 22294.8 Da    PI: 8.7854
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00027319-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof99.22.6e-311771559
                 zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59
                            ++cprC stntkfCyynny+ sqPr+fCk+C+r+WtkGG+lrn+P    rr+++
  SMil_00027319-RA_Salv 17 PSECPRCGSTNTKFCYYNNYNKSQPRHFCKSCKRHWTKGGTLRNIPAARRRRNKR 71
                           689*******************************************876666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-17761IPR003851Zinc finger, Dof-type
PfamPF027019.1E-281870IPR003851Zinc finger, Dof-type
PROSITE profilePS5088425.4711872IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102056IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MIQQFPGEQS GASKPPPSEC PRCGSTNTKF CYYNNYNKSQ PRHFCKSCKR HWTKGGTLRN  60
IPAARRRRNK RPRASAAAAT EPRQKRLLNS NDQNRMSDIL YQALIRSSPH QGTILESNGT  120
TCAAATQNYT NTEDLMLSSF TSAPTSAEIV DLTEESSAAA PWAAELWSWN DEIDFLASLW  180
DRSDAEMMTP YKPIYQGY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096259.15e-36PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLF6HJS11e-33F6HJS1_VITVI; Putative uncharacterized protein
STRINGVIT_00s0652g00010.t014e-33(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-23TARGET OF MONOPTEROS 6