PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00027279-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 559aa    MW: 61229.6 Da    PI: 6.4664
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00027279-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.71.1e-094014381954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps++++  L++++gL+++qV++WF N R +
  SMil_00027279-RA_Salv 401 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 438
                            664459******************************88 PP

2BELL99.52.6e-32262332171
                   BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                            er+e q++k kLls+l+eV+ rY +y+eq+q+v++sF+ v+g g+a+pYt lA +a+S+hFr++k+a+a  
  SMil_00027279-RA_Salv 262 ERTEYQRRKIKLLSMLDEVEGRYMRYCEQMQAVVNSFDGVMGQGAAAPYTGLARRAMSQHFRSMKEAVARE 332
                            789*****************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.3E-52198331IPR006563POX domain
PfamPF075262.4E-43204329IPR006563POX domain
PROSITE profilePS5007112.309379442IPR001356Homeobox domain
CDDcd000869.96E-12382443No hitNo description
SMARTSM003894.4E-9382446IPR001356Homeobox domain
SuperFamilySSF466893.89E-17383450IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-28385448IPR009057Homeodomain-like
PfamPF059205.9E-18399438IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 559 aa     Download sequence    Send to blast
MSQSFHQGIY HFPNANEWMI RDQAGGFEAP PPPPPPAFDA GGMLTEIINR PWRKPCGDDQ  60
IQPTQKQQLS SLAVNELPAS SNLQGFHLIP ASNMQPPSQM SWIPSNGGGG RSEEVAARGG  120
GVLEGQGLSL SLSSLRNLEG SKFEKMNMGN NGDLYFHGQG IGSSSNSYVL EDVGTNPMLF  180
GSPRLVSDQI HIGYVESARS SSLVRNSRYL KAAQELLLEF CCVGRGNHNH KQERNPNSAS  240
DGGGGGGLSS SKDHHLALSP SERTEYQRRK IKLLSMLDEV EGRYMRYCEQ MQAVVNSFDG  300
VMGQGAAAPY TGLARRAMSQ HFRSMKEAVA REVRACCEAL GEKDVQGGGI TKGETPRLKV  360
VEQKYRQHKA LQHMGMMDPE SWRPQRGLPE RSVTILRAWL FEHFLHPYPS EADKHLLSRQ  420
TGLSKNQVSN WFINARVRLW KPMVEEMYQQ EFQEAKDDEG SHEANSESTA AERDPSEPGK  480
QAAAPVGGAA ADDMMMPTEY RCFMENPEMG LGSEFGGGGG GGGNVAAQAA GEVSLTLGLR  540
RSENVPIMSH LSVRDFEAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B8e-17388445158Homeobox protein Meis1
4xrs_A8e-17388445158Homeobox protein Meis1
5bng_A9e-17388446159Homeobox protein Meis2
5bng_B9e-17388446159Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011074481.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-111BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLK4BV621e-155K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.11e-155(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-109BEL1-like homeodomain 2