PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00026538-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 239aa    MW: 25114.1 Da    PI: 4.6611
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00026538-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.61.6e-392382362
                 zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                           +++lkcprCds+ntkfCyynny+lsqPr+fC++C+ryWtkGGalrn+PvGgg+rkn k+s
  SMil_00026538-RA_Salv 23 QEQLKCPRCDSANTKFCYYNNYNLSQPRHFCRSCKRYWTKGGALRNIPVGGGSRKNSKRS 82
                           7899****************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.7E-332480IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1242680IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-202671IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102864IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MQNPSLYSQI QAQAQQQPQF PDQEQLKCPR CDSANTKFCY YNNYNLSQPR HFCRSCKRYW  60
TKGGALRNIP VGGGSRKNSK RSSSTSSSAD SAASKRPAVA ASPPPSASKD EKNSDRDKAR  120
EVFDTLPLRE ENFSGQFESL SFSSLLGSGG DQYVGLLDGL GPNGPDLEIN GHFDETGSGP  180
NANPALDGEG DEFLNLQGGV GGGGEGEGGG CDGGGWGGGG GGGGDWPDLS IYTPSSNFQ
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012856207.15e-67PREDICTED: dof zinc finger protein DOF3.1
SwissprotO821551e-42DOF17_ARATH; Dof zinc finger protein DOF1.7
TrEMBLA0A2G9GGT23e-71A0A2G9GGT2_9LAMI; Uncharacterized protein
STRINGMigut.I01007.1.p2e-66(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.16e-28DOF zinc finger protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]