PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00025820-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family CO-like
Protein Properties Length: 319aa    MW: 35342.5 Da    PI: 5.4289
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00025820-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box301.1e-091146439
               zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkgHtv 39
                           + C+ ++  +++ fC+ ++ +lC++C +  H +H +
  SMil_00025820-RA_Salv 11 KPCDSCKAAPATVFCRADSAFLCATCDTDLHARHAR 46
                           67********************************76 PP

2zf-B_box26.51.3e-084789339
               zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                            ++C+ +e+ ++   C+ ++  lC+ C   +H+       H++
  SMil_00025820-RA_Salv 47 VWVCDVCEQAPAAVTCKADDAALCPACDADIHSAnplarrHER 89
                           689*****************************65777777776 PP

3CCT69.67.9e-24262306145
                    CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                            Rea+++RYkeKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF++++e
  SMil_00025820-RA_Salv 262 REARVMRYKEKRKNRRFEKTIRYASRKAYAETRPRIKGRFARRSE 306
                            9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.537849IPR000315B-box-type zinc finger
SMARTSM003369.3E-9849IPR000315B-box-type zinc finger
PfamPF006433.7E-71146IPR000315B-box-type zinc finger
CDDcd000218.49E-111249No hitNo description
PROSITE profilePS5011910.1394592IPR000315B-box-type zinc finger
PfamPF006431.1E-64791IPR000315B-box-type zinc finger
CDDcd000217.16E-94892No hitNo description
SMARTSM003361.2E-85092IPR000315B-box-type zinc finger
PROSITE profilePS5101716.817262304IPR010402CCT domain
PfamPF062031.2E-17262304IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MGGDSWSLTA KPCDSCKAAP ATVFCRADSA FLCATCDTDL HARHARVWVC DVCEQAPAAV  60
TCKADDAALC PACDADIHSA NPLARRHERF PVVPFYHAAV KTPRSADFSE EEVEAASWIL  120
PDPNTKPLED SGSPAEYMFS DMDPDPYPDL DLMHKPGHII VDDKKQYSTD GVVPVQTEKE  180
YGSGHYPGPV VDGYPTYDVD YPASKPFMYN FTSQSISHSV SSSSLEVGVV PEPEPEPEPE  240
HNGNGDASKV EIAPTRVSGM EREARVMRYK EKRKNRRFEK TIRYASRKAY AETRPRIKGR  300
FARRSELQID ASYGVVPTF
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8977885e-48AB897788.1 Lemna gibba LgCOH1 mRNA for CONSTANS-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078988.11e-142zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ9FHH81e-83COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A022QPG51e-138A0A022QPG5_ERYGU; Uncharacterized protein
STRINGMigut.E01434.1.p1e-139(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.14e-64CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]