PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00025758-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 540aa    MW: 60043.7 Da    PI: 4.645
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00025758-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM104.91e-3271333128
                    NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                            pGfrFhPt  +  +    +k +++  +  + +     +++ P  ++    k+k+++ ewyfFs  dkky +g r+nrat++gyWk+tg
  SMil_00025758-RA_Salv   7 PGFRFHPTMRNWCSIICGEKPAENFADS-TLLLMSMSTRSSPGIFHVymsKLKTRDLEWYFFSFLDKKYGNGARTNRATEKGYWKTTG 93 
                            9*******99999776666666665555.5555556677788877633346666778******************************* PP

                    NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            kd++v++ k++ vg+kktLv++ grapkg++++Wvmheyrl
  SMil_00025758-RA_Salv  94 KDRPVYH-KRQIVGMKKTLVYHCGRAPKGQRSNWVMHEYRL 133
                            *******.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.26E-384156IPR003441NAC domain
PROSITE profilePS5100539.4565156IPR003441NAC domain
PfamPF023652.6E-177133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MSNMLGPGFR FHPTMRNWCS IICGEKPAEN FADSTLLLMS MSTRSSPGIF HVYMSKLKTR  60
DLEWYFFSFL DKKYGNGART NRATEKGYWK TTGKDRPVYH KRQIVGMKKT LVYHCGRAPK  120
GQRSNWVMHE YRLAGSELEN AGAAKDAFVV CRIFQKSGSG PKNGEQYGAP FVEEEWDDDE  180
LVSVPQDDAR QEIDFGDNAY LNCDDLQQIL GSDVPLNITP VSSDGSHDGE ATNTFGGTQN  240
PFEFAGDGYG ESKMCYDPNI QNLPAKQEGL GACSKSGNSE FADDLSLFLN EPFLDSFENF  300
PNADEGFIEA NDLSNPYETN TSTFDMLAEY LDASDDNSSL YFSSDPAMIF GNEDLASNQT  360
LLPQMNVGNE TEKAILPSGQ LIDNNNFDAA FSPNKHTSTE YQSDIQYPYI KQASRMLGNI  420
HAPPAYAAEF PSKDAIRRLN FVTRSPSSVE LSASTIRIRN LNTCGKGTDQ SSGKHEDFNI  480
VLSFGFSRGD DGSSSLESSV RIVPGKADSA ISRGWLCFIF FWILIFSMMS FRFGNYIGVK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-29516217171NO APICAL MERISTEM PROTEIN
1ut4_B2e-29516217171NO APICAL MERISTEM PROTEIN
1ut7_A2e-29516217171NO APICAL MERISTEM PROTEIN
1ut7_B2e-29516217171NO APICAL MERISTEM PROTEIN
3swm_A1e-29516220174NAC domain-containing protein 19
3swm_B1e-29516220174NAC domain-containing protein 19
3swm_C1e-29516220174NAC domain-containing protein 19
3swm_D1e-29516220174NAC domain-containing protein 19
3swp_A1e-29516220174NAC domain-containing protein 19
3swp_B1e-29516220174NAC domain-containing protein 19
3swp_C1e-29516220174NAC domain-containing protein 19
3swp_D1e-29516220174NAC domain-containing protein 19
4dul_A2e-29516217171NAC domain-containing protein 19
4dul_B2e-29516217171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011076897.10.0NAC domain-containing protein 53 isoform X1
TrEMBLA0A2G9I3Z20.0A0A2G9I3Z2_9LAMI; Uncharacterized protein
STRINGMigut.F01687.1.p1e-179(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31412450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04410.18e-89NAC domain containing protein 2