PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00025053-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family bZIP
Protein Properties Length: 193aa    MW: 22313.5 Da    PI: 6.2322
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00025053-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.43.1e-1379135561
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                            +++rr+++NRe+ArrsR RK+  ++eL   v  L + N+ L+++++e+++  +++ +
  SMil_00025053-RA_Salv  79 RKQRRMISNRESARRSRMRKQRHLDELWSQVLRLRSDNHNLIEKMNEMSESHDRVVQ 135
                            79****************************************999999887766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.4E-1575139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.2E-1176129No hitNo description
PROSITE profilePS5021710.95577140IPR004827Basic-leucine zipper domain
SuperFamilySSF579596.25E-1279128No hitNo description
PfamPF001705.1E-1179132IPR004827Basic-leucine zipper domain
CDDcd147023.00E-1780131No hitNo description
PROSITE patternPS0003608297IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MIQSNSQQTN YFASSNPSIF PTNFSLTRTN SPALELSRLL ADIPNNHQLQ EFTPYSSCIS  60
NNSTSDEAEE HQLSIHDERK QRRMISNRES ARRSRMRKQR HLDELWSQVL RLRSDNHNLI  120
EKMNEMSESH DRVVQENARL KEEAADLQRK LMDVQVSNSY SIFSDLDELS CNSAHLQAES  180
SNHSLTPSTD LLH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19198RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077776.12e-86basic leucine zipper 43
SwissprotQ9FMC21e-34BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A4D9A9A02e-86A0A4D9A9A0_SALSN; Uncharacterized protein
STRINGXP_009774323.11e-72(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-45basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]