PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00024911-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 90aa    MW: 10590.1 Da    PI: 10.4584
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00024911-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.73.5e-403188461
                 zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                             +kcprCds+ntkfCyynnyslsqPryfCkaCrryWt+GG+lrnvPvGgg+rk+k+ 
  SMil_00024911-RA_Salv 31 PPQKCPRCDSANTKFCYYNNYSLSQPRYFCKACRRYWTHGGTLRNVPVGGGCRKSKRP 88
                           5689***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027012.0E-343387IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.2083387IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-243487IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103571IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MEPRRNDQDR LKHQQDHRVK PPETQQMAPP PPQKCPRCDS ANTKFCYYNN YSLSQPRYFC  60
KACRRYWTHG GTLRNVPVGG GCRKSKRPKP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:30626969}.
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. May enhance the DNA binding of the bZIP transcription factor Opaque-2 to O2 binding site elements.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:30626969}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096324.23e-39dof zinc finger protein DOF3.1
SwissprotO244632e-32PBF_MAIZE; Dof zinc finger protein PBF
SwissprotQ84TE91e-32DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A4D8ZBK72e-38A0A4D8ZBK7_SALSN; Uncharacterized protein
STRINGGorai.009G168400.19e-36(Gossypium raimondii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.17e-33TARGET OF MONOPTEROS 6
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Lang Z, et al.
    Defining the Role of prolamin-box binding factor1 Gene During Maize Domestication.
    J. Hered., 2014 Jul-Aug. 105(4): p. 576-582
    [PMID:24683184]
  3. Zhang Z,Zheng X,Yang J,Messing J,Wu Y
    Maize endosperm-specific transcription factors O2 and PBF network the regulation of protein and starch synthesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(39): p. 10842-7
    [PMID:27621432]
  4. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]