PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00024298-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 187aa    MW: 21196 Da    PI: 9.5177
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00024298-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.91.9e-371673461
                 zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                           + l+cprC+s+ntkfCyynnyslsqPr+fC+aC+ryWt+GG+lrnvP+Ggg rk kk 
  SMil_00024298-RA_Salv 16 DPLPCPRCNSSNTKFCYYNNYSLSQPRHFCRACKRYWTRGGTLRNVPIGGGYRKTKKF 73
                           5789***************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027013.8E-331772IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9471872IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-241872IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102056IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MASLSANSVM QRSEADPLPC PRCNSSNTKF CYYNNYSLSQ PRHFCRACKR YWTRGGTLRN  60
VPIGGGYRKT KKFKRPPPPP APNPFHTMHM APLHLNFPFL ETRVSSDTPR FDHTHAPKSG  120
FSPYFRNGFE QNIEDRADFI GFGSSNFAQQ MPCEEMQVVV GSGQIGNQIE QISSSSFYGI  180
QRRCCLV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020554179.12e-38LOW QUALITY PROTEIN: dof zinc finger protein DOF1.4-like
TrEMBLA0A2G9G7Z71e-35A0A2G9G7Z7_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.19e-34Dof family protein