PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00024159-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family NAC
Protein Properties Length: 182aa    MW: 20832.4 Da    PI: 5.0752
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00024159-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM116.33.1e-3681261128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrF Ptdeel+v++L++k++  + +  +vi+++++y ++PwdL+ k+ +e ++wyf+s+r         +nr+t++gyW+  g 
  SMil_00024159-RA_Salv   8 LPPGFRFYPTDEELLVHFLHRKAALLPYHP-DVIPDLHLYPYDPWDLDGKAMSEGRQWYFYSRR--------TPNRITETGYWQPIGV 86 
                            79*************************998.99**************977778899******97........579************* PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            + +++s+ g++vg+kk  +fy g+ ++g+kt+W+mhey++
  SMil_00024159-RA_Salv  87 EDPIFSSAGKKVGVKKYCAFYIGEPSQGVKTNWIMHEYKA 126
                            **************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.62E-465150IPR003441NAC domain
PROSITE profilePS5100545.3078151IPR003441NAC domain
PfamPF023651.3E-219125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010089Biological Processxylem development
GO:0043067Biological Processregulation of programmed cell death
GO:0048367Biological Processshoot system development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MGDNKLNLPP GFRFYPTDEE LLVHFLHRKA ALLPYHPDVI PDLHLYPYDP WDLDGKAMSE  60
GRQWYFYSRR TPNRITETGY WQPIGVEDPI FSSAGKKVGV KKYCAFYIGE PSQGVKTNWI  120
MHEYKASNSS AKKTSSKIDR SKWVLCRVYE EDDDGGGGTE LSCLDEVFLS LDDLDEISLP  180
NS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-46415513169NO APICAL MERISTEM PROTEIN
1ut4_B6e-46415513169NO APICAL MERISTEM PROTEIN
1ut7_A6e-46415513169NO APICAL MERISTEM PROTEIN
1ut7_B6e-46415513169NO APICAL MERISTEM PROTEIN
3swm_A6e-46415516172NAC domain-containing protein 19
3swm_B6e-46415516172NAC domain-containing protein 19
3swm_C6e-46415516172NAC domain-containing protein 19
3swm_D6e-46415516172NAC domain-containing protein 19
3swp_A6e-46415516172NAC domain-containing protein 19
3swp_B6e-46415516172NAC domain-containing protein 19
3swp_C6e-46415516172NAC domain-containing protein 19
3swp_D6e-46415516172NAC domain-containing protein 19
4dul_A6e-46415513169NAC domain-containing protein 19
4dul_B6e-46415513169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011092697.12e-98NAC domain-containing protein 104 isoform X1
RefseqXP_020553092.12e-98NAC domain-containing protein 104 isoform X1
RefseqXP_020553093.12e-98NAC domain-containing protein 104 isoform X1
SwissprotQ8GWK64e-75NC104_ARATH; NAC domain-containing protein 104
TrEMBLA0A4D9BY501e-101A0A4D9BY50_SALSN; Uncharacterized protein
STRINGXP_009762857.13e-88(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37662447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G64530.15e-73xylem NAC domain 1
Publications ? help Back to Top
  1. Zhao C, et al.
    XYLEM NAC DOMAIN1, an angiosperm NAC transcription factor, inhibits xylem differentiation through conserved motifs that interact with RETINOBLASTOMA-RELATED.
    New Phytol., 2017. 216(1): p. 76-89
    [PMID:28742236]
  2. Tang N, et al.
    Natural variation at XND1 impacts root hydraulics and trade-off for stress responses in Arabidopsis.
    Nat Commun, 2018. 9(1): p. 3884
    [PMID:30250259]