PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00023483-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family WOX
Protein Properties Length: 213aa    MW: 24468.4 Da    PI: 8.9093
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00023483-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.28.8e-211776357
                           --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
               Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                           +R+++tkeq++ Le+l+++  r+p+a+++++++++l    +++ ++V++WFqN++a++++
  SMil_00023483-RA_Salv 17 SRWNPTKEQINMLESLYRQgLRTPTADQIQHITARLrdygHIEGKNVFYWFQNHKARQRQ 76
                           6*****************99**************************************97 PP

2Wus_type_Homeobox116.41.4e-371778465
      Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                           +RW+Pt+eQi++Le+ly++GlrtP++++iq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqkq
  SMil_00023483-RA_Salv 17 SRWNPTKEQINMLESLYRQGLRTPTADQIQHITARLRDYGHIEGKNVFYWFQNHKARQRQKQ 78
                           8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.59E-131284IPR009057Homeodomain-like
PROSITE profilePS5007110.4791277IPR001356Homeobox domain
SMARTSM003891.9E-41481IPR001356Homeobox domain
PfamPF000462.4E-181776IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.8E-81776IPR009057Homeodomain-like
CDDcd000861.70E-51878No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
LLITMEGGDQ NPANGGSRWN PTKEQINMLE SLYRQGLRTP TADQIQHITA RLRDYGHIEG  60
KNVFYWFQNH KARQRQKQKQ ETFAFYNRFL HSPPPLFPPP PPFHNVICSP CYIPPPKKVQ  120
LPTALGSVKR CRTIPQSIDS SHLTLTQRYN TTESREHLNS SSHDQETLDL FPIHPTGILQ  180
STSNHDQKNP SFCADKLSTS SDDHPFFDFF RGN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077272.13e-75WUSCHEL-related homeobox 2
TrEMBLA0A4D9BTG54e-96A0A4D9BTG5_SALSN; Uncharacterized protein
STRINGMigut.F01969.1.p7e-65(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-43WUSCHEL related homeobox 2