PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00023076-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family Dof
Protein Properties Length: 325aa    MW: 35893.2 Da    PI: 8.7304
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00023076-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.33.9e-39113172261
                 zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                            ++k+l+cprC+s++tkfCyynny+++qPr+fCk+C+ryWt+GG++rnvPvG+grrknk++
  SMil_00023076-RA_Salv 113 PDKILPCPRCNSADTKFCYYNNYNIKQPRHFCKSCQRYWTAGGTMRNVPVGAGRRKNKTA 172
                            7899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-29110170IPR003851Zinc finger, Dof-type
PfamPF027012.5E-32115171IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.584117171IPR003851Zinc finger, Dof-type
PROSITE patternPS013610119155IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
LVLRLTNPWR GMKEPEIKLF GRKIVLPDKG GAVAAGEFSG RSSCVSDGDD RCLEASGEKG  60
EAHHEIQLHA LEEHQEAEEC ESRDENAEEP RNPAAESSEM DENGQQKAAL KKPDKILPCP  120
RCNSADTKFC YYNNYNIKQP RHFCKSCQRY WTAGGTMRNV PVGAGRRKNK TAATSPPPRP  180
IWRRFRAVVR PRSRAHQEIR RAHQEWRAAA AAAAAATRDA VPYDPLESGN LPDADAGKHS  240
RSGDEVDKGR SILVPKTLRI DDPEEAAKSS IWETLGIKYD SVSREGLFKA LQPKPGREKI  300
SISAASALQA NPAAFSRSIS FQEGV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A4D8ZXT22e-84A0A4D8ZXT2_SALSN; Dof zinc finger protein DOF5.5
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-38cycling DOF factor 2